(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE220

ASPNC_1.PE220        Location/Qualifiers
FT   CDS_pept        join(complement(565093..565630),complement(564646..565031),
FT                   complement(563926..564560),complement(563523..563860),
FT                   complement(563061..563104),complement(562807..562889),
FT                   complement(562453..562771))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160714" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959926"
FT                   /orf_name="An01g02330"
FT                   /product="Similarity to pyoverdine biosynthesis protein
FT                   PvcA - Pseudomonas aeruginosa"
FT                   /protein_id="CAK43603.1"
FT                   /db_xref="InterPro:IPR007817"
FT                   /db_xref="UniParc:UPI0000EF9E9D"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Y0"
FT                   /transl_table=1
FT                   /translation="MEQGFGPDIIPLEIDMFPMESDNFLMEREFFHMKSDLVSMESGVV
FT                   PMESDIFPMESTIDPQVSERKYENDPLLKAFEIMEIIGRYRTMVPATASDRTSDGNIMF
FT                   LSKMWSQIRAKQPIRMILPAFPFKSPNQGNKTLGSLPDKGEEICLAHLNGLCAAISDVY
FT                   EYGAKLTIVSDGLVYNDILGVSDRDVWEYGHALREMVAENKYDHIEFARLRDLVHSHED
FT                   VKLDGETYERLAPVFRQELIEQHTPVGFDAAVMIKSDENICTTYRGYIKFLTKDLEHLY
FT                   VENGTTSRKAHKKYLGNVAKAMITRGAAFAEAIIKNYSGYIRLSIHPSNGLTKISINVL
FT                   PRSSKPVTPWHSAPCYTVDGRFIYGWREVFDANPELELVHKNGRPWCYRFISELYNWSS
FT                   PVAVDPIYPCGMMITPLNPTSISQVEMEKVQGLAHENSPVVLRGFTDTHDHELIAQKAE
FT                   SVDASYLSISDFNPEEKAEDGDSQDSKSTTLSGWLPYDGPTEIMEDQEAHHIKQCPVSS
FT                   PAKYQLISAPGPISENTRRSLFSASPLFFHHLPASYTVGILQQLSWNAETSSHDTETSS
FT                   LPLIIPHFSHGRPCFRYHSLLSQSNITCDPTLIAIEDISTADSTRLCNILNPLLYDRNI
FT                   PEKYQIQELVRHATTVGNETGKYRHNYATLIRGKAKELQIKWSDPEVTLLLRWSLQHPT
FT                   AFFWGTGIFSKKGSVRPTPLERDTKSSDVKRGEHNVQLITRLKILWSSSPLRFLQGDRQ
FT                   TDRQTARNQQRRPPAGPQALSTLSTPA"
     atggaacaag gatttggacc agacatcatt cccttagaga ttgacatgtt tcctatggag        60
     tcagacaatt tccttatgga gagagagttc ttccatatga agtcagatct cgtctctatg       120
     gagtcaggcg tcgttcccat ggagtcagac attttcccta tggagtcgac tatcgaccca       180
     caagtctcag aacgcaagta cgagaacgat ccactgctaa aggcctttga gatcatggaa       240
     atcatcggtc ggtatcgtac catggtgcca gcaaccgcaa gtgatcgcac cagcgacgga       300
     aacattatgt ttctatccaa gatgtggtct cagatccggg ccaaacagcc gatccgaatg       360
     attctaccgg ctttcccctt caagtctccg aatcagggaa ataagacttt gggaagcctt       420
     cctgacaaag gcgaagagat ttgtctcgcg caccttaacg gactctgcgc tgctattagt       480
     gacgtctatg aatatggagc taagctcacc attgtatctg atggcctcgt gtacaacgat       540
     atcctgggcg tttctgacag agacgtctgg gaatatggcc atgcactgag ggaaatggtt       600
     gctgaaaata agtacgacca tatcgagttc gccagactgc gcgaccttgt tcacagccat       660
     gaggacgtca aacttgacgg agagacgtac gaaaggttgg ccccggtgtt tcgccaggaa       720
     ctaattgaac agcacacacc ggtgggattt gacgccgctg ttatgatcaa gtcagacgaa       780
     aacatctgca ccacttatcg aggatacata aagttcttga ccaaggacct ggaacatctt       840
     tatgtagaga atggtaccac atctcgcaag gcacacaaga agtacctggg gaatgttgcc       900
     aaagccatga tcacacgagg cgcggccttt gcagaagcca tcataaagaa ctactcaggt       960
     tacatccgtc tttcaatcca tccatcaaat ggattaacca agatctccat aaatgttctc      1020
     ccgagatcct caaaaccagt cacaccatgg cactcagcac cttgctatac tgttgacggc      1080
     cgcttcatat atggatggcg cgaagttttc gatgctaacc cagaattgga gttagtccac      1140
     aaaaacgggc gtccatggtg ctaccgtttt atatctgagc tgtacaactg gtcatcgccg      1200
     gtagcagtcg atcccatcta tccctgtggc atgatgatca cgcctctcaa tccaacctca      1260
     ataagccagg ttgaaatgga gaaagtgcag ggtctagcac acgagaactc accagttgtc      1320
     cttcgcggat ttacagacac tcatgaccat gagctgatcg cgcagaaagc tgagagcgtt      1380
     gacgcttctt acctttcgat atccgacttc aatcctgaag aaaaagccga agatggtgat      1440
     tcacaagatt cgaaaagcac taccttgtca ggttggctgc cctacgatgg gccaactgag      1500
     atcatggagg atcaagaagc ccatcacatc aagcagtgtc cggtctcctc tccagccaaa      1560
     tatcagctca tcagtgcccc tggccctatc tcagagaaca ccagacgcag tcttttctcc      1620
     gcatcccctc tgtttttcca ccaccttcca gccagctaca ccgtcggcat actccagcaa      1680
     ctttcctgga acgcagagac ttcatcccac gacactgaga ccagttccct gcccttgatc      1740
     ataccgcact tttctcacgg ccggccctgc ttccgttacc actcgctcct ctctcaaagc      1800
     aatatcacct gtgatcccac tctcatcgcc atcgaagata tctcaaccgc tgactcaact      1860
     agactatgca atatcctgaa tcctctcctc tatgaccgga atattcctga gaaataccag      1920
     atacaggagc tagtcagaca tgcaactacg gtaggaaacg agacaggcaa atacagacat      1980
     aactatgcta ctctcataag aggaaaggca aaagaactac aaattaaatg gtctgaccca      2040
     gaagtaactt tactattaag atggtcactc caacatccta ctgccttttt ctggggtact      2100
     ggcatatttt caaagaaggg atctgttaga ccaacaccac ttgaacgaga cacgaaaagc      2160
     tctgatgtaa aaagaggcga gcacaatgtg cagctaatta ctaggttgaa aatactgtgg      2220
     tcttcctctc cactgaggtt tcttcaggga gacagacaga cagatagaca gacggcaagg      2280
     aatcaacagc ggagaccccc ggccggcccc caagctttaa gtacactatc tacccctgca      2340
     taa                                                                    2343
//

If you have problems or comments...

PBIL Back to PBIL home page