(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE225

ASPNC_1.PE225        Location/Qualifiers
FT   CDS_pept        join(579029..579144,579237..579394,579688..579754,
FT                   579875..580034)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876776"
FT                   /orf_name="An01g02380"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43608.1"
FT                   /db_xref="UniParc:UPI0000EF9EA2"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Y5"
FT                   /transl_table=1
FT                   /translation="MEEARERKRERTVWRDGMDRSIVVGGRGGQRRQDKKDRRERKGRD
FT                   LGGAERLVEEVVNEQEGERAEEEIDNRGRKWVSMEMDGGGDDDDDEGSPSVIDLPGGST
FT                   TGGYSFSFFSVDRIFARESSVAQFPHPFFPLCWPIPIPFAYGLPRSNLPGSTASYYGLV
FT                   NWV"
     atggaggagg ctcgagagag aaagagagag agaacggtct ggagagatgg gatggataga        60
     tcgatcgttg ttggtgggag gggaggacag cggcgacagg acaagaaaga tcggcgggaa       120
     aggaaaggaa gggatttagg gggggctgag cggttggtgg aggaagtggt gaatgagcaa       180
     gaaggcgaga gagccgagga agagattgat aatagaggca ggaagtgggt aagtatggaa       240
     atggatggtg gtggtgatga tgatgatgat gaaggcagcc cttctgttat cgatctccca       300
     gggggatcta cgaccggggg ctattccttt tccttcttct cggtggacag aatttttgcg       360
     cgtgagagct cggtcgcgca gttccctcac ccttttttcc ctctttgctg gccaattcca       420
     atcccatttg cctacggcct ccccagatcg aatctcccgg gctccaccgc ttcctattac       480
     ggtttagtga actgggtcta a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page