(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE23

ASPNC_1.PE23         Location/Qualifiers
FT   CDS_pept        join(57893..58022,58074..58217,58597..59378)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175005" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874689"
FT                   /orf_name="An01g00250"
FT                   /product="Catalytic activity: NADH + Nitrate  "
FT                   /EC_number="1.7.1.1"
FT                   /function="heme binding"
FT                   /function="nitrate reductase (NADH) activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK43417.1"
FT                   /db_xref="GO:0009703"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG591994"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="UniParc:UPI0000EF9EF3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7D3"
FT                   /transl_table=1
FT                   /translation="MAQSVPLESTASMGADSQLTEYTLADIAKHNRKDDIWIAVHGQVF
FT                   DITEYLQDHPGGVDVLLETAGSDATTAFEDVGHSEDSREILQEYLIVVRADPHMAKGFL
FT                   DSKEYQRLPLVQKDLLSPNVYRFVFALPDTKGVIGLPIGQHVAIRANIDGNTVSRSYTP
FT                   VSNNLDLGRLELVVKCYPDGLLSGKYLANLTVGDEVEFRGPKGAMRYGRGLCAKIGMVA
FT                   GGTGITPMYQLIRAICEDERDTTEISLIYANRSEGDILLREELEDFARKYPKNFKLWYM
FT                   LDTAPEGWMYGSGYVNEAVLRERLPDPSAETKIMLCGPPGMVNACKKTLGVIGFQTSGT
FT                   ISKMSDQIFCF"
     atggcccaat ctgtgccctt agagtctaca gcctcgatgg gagctgattc ccagcttacc        60
     gagtatactt tggccgatat tgccaagcat aatcgcaagg atgacatctg gattgctgtc       120
     cacgggcaag tttttgacat cactgagtac ctgcaggatc atccaggagg cgtggatgtt       180
     ctcctagaga ctgcaggctc tgacgccacc acagctttcg aggatgtcgg ccattccgaa       240
     gactccaggg agatcttgca ggagtacttg atcgtggtcc gggcagaccc tcatatggct       300
     aagggcttcc tcgactcgaa ggaataccaa cgtctacctt tagttcagaa ggatctattg       360
     tcgcccaatg tgtaccgatt tgtattcgct ttgcctgata cgaaaggggt gattggactt       420
     cccattgggc agcatgttgc catccgcgct aatattgatg ggaacaccgt gagccgatcc       480
     tacacccctg tttccaacaa cttggacctg ggccgactcg aactggtcgt caagtgttat       540
     cctgacggtc tactgagcgg taaatacctt gccaacctga ctgttgggga cgaggtggag       600
     ttcaggggac ccaagggagc gatgcgatac ggccgagggc tttgtgccaa gattggaatg       660
     gtagctggcg gaacaggcat cacccccatg tatcaactca ttcgggccat ttgcgaggac       720
     gagcgtgaca cgaccgagat cagtctgatc tatgctaacc ggagcgaggg agacatcctg       780
     ctacgcgagg agctggaaga ttttgctcgc aagtatccca agaacttcaa actctggtac       840
     atgctggata cggcccccga ggggtggatg tatgggtcgg gctacgtgaa cgaagctgtc       900
     ctccgtgaac gattgccaga cccatcagca gagactaaga ttatgctctg tggaccccca       960
     ggcatggtga atgcgtgcaa aaagaccttg ggcgtaattg gattccagac gtcaggaacg      1020
     atctcgaaga tgagcgacca gatcttttgt ttctag                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page