(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE234

ASPNC_1.PE234        Location/Qualifiers
FT   CDS_pept        join(complement(597539..597616),complement(597180..597479),
FT                   complement(596831..596926))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876780"
FT                   /orf_name="An01g02480"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43617.1"
FT                   /db_xref="UniParc:UPI0000EF9EAB"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Z4"
FT                   /transl_table=1
FT                   /translation="MDLPSPIAARLDRIGVRPRYPGISWIAWSGAVSAYQLLLFLGAVE
FT                   GWRIFLDTSIVIYICDGGMKDPISWAAAPVLSAQLGKGDKFINLAAAACRLMLVLLCVD
FT                   VLTAGQRCFYGMVMELETFPSMGLTGRIWRIINWLSRSRATTTAAAADGTRRS"
     atggacctgc ctagcccaat tgctgctcgg ctggatcgta taggagtgag gccgaggtat        60
     cccggaataa gctggattgc ctggtctggg gctgtctctg cataccaatt actattattc       120
     ttgggggctg tagaaggatg gaggatcttc ctagatactt caatagtaat ctacatatgc       180
     gatggaggaa tgaaggatcc gatcagttgg gcggcagcgc cagtgctgtc agcacaactc       240
     ggaaagggtg acaaattcat taatctggct gctgcagcct gcaggctcat gcttgtgcta       300
     ctgtgtgttg atgtgcttac agcgggtcag cgctgtttct atggaatggt tatggaattg       360
     gaaacattcc cttccatggg gttaaccgga aggatttggc gaataattaa ttggttgtcg       420
     cgttctcgtg ctactactac tgctgctgct gctgacggga cacgacgctc atag             474
//

If you have problems or comments...

PBIL Back to PBIL home page