(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE237

ASPNC_1.PE237        Location/Qualifiers
FT   CDS_pept        complement(602579..604975)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175710" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876783"
FT                   /orf_name="An01g02510"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43620.1"
FT                   /db_xref="HOGENOM:HBG329819"
FT                   /db_xref="UniParc:UPI0000EF9EC6"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Z7"
FT                   /transl_table=1
FT                   /translation="MAIWPFGRKNKRHTIQLDAPAVADVQSSQEPRHSFDDGKLGRLSR
FT                   KHSKRQKNRHAQPVEVVPSFLHDASHPTSSPVVQYPPPTSHSEQPTPMKENRVPVSRAG
FT                   QHSDAYTTYSTMSHEQPSLSRSASLLKSKRNENGPAVLKKKLSKRKAYEIAREREIRML
FT                   ASAPIDIPRRPSPLPGEQFSIETRRANGAQSRRSDRHCSDTSLSMRDSAASSLSDIFES
FT                   YTFKVNTFAAWTPRPVIRYVEAPRVSTAKSQRPSEPSIRKDKTPAYATHNEHSRSKKRV
FT                   DKLADDLDAGALRELLERDRRRRERKQLEDQARLHRKLQRAAEQQRQAEAEAEADAVPQ
FT                   EPSSEAEDTSLAPRGRPGAESRAVSDRSKEYAPRTNETNAFLGGNSSGSWLRGASKDTD
FT                   RRGRESVDSVHVIGNIDDSSIREPKLVMRRSFAPSQDMGMSGSSLSHSPSRRELYSPTS
FT                   SQLYGIGRESTSDISRTIDSDRRLSDHGSGRVNTLTSIFRRGSSRLKRSYRERFHERSP
FT                   EHSNPSHESFFKVQTQSSGPPPSFVTAPRTFLGSGTIKRSQSKFTEHFGDEPLSPPDSR
FT                   LQSPDIPEVLDEFEREDEMSDINMGTQYPIPSSGSEPQDIPRNPHHSWTGDSWEGDPDN
FT                   LPLSQSLASIDSEGSWMSGQFLRRISQKKASNPLRTSLSSSRNIMEEGHEGSSNGDDVP
FT                   VSEPLVRFGTNQDEGLKSGPDVAGASPDKDSPMDSVPEQAEETWHDQIARRPVLVTPAI
FT                   RPKSNEGLLKNVQSFCAEEEFSPIEEHSAEFELETSDNHGNGRSN"
     atggcgatat ggccgtttgg tcgtaagaac aagcggcata cgatccaact ggatgcacct        60
     gccgtggcgg atgtccagtc gtcacaagag cctcgccaca gcttcgatga cggcaagctc       120
     ggcagactgt cccgcaagca ctccaaacgt cagaagaaca gacacgccca gcccgtcgaa       180
     gtcgtcccga gctttttgca cgatgcctct catccgacgt cttctcctgt cgtccagtac       240
     cctccaccta cgtcacacag tgagcaaccg accccgatga aagaaaaccg ggtcccggtc       300
     tcccgagcag gccagcattc cgatgcctac acaacttact ccaccatgag ccacgaacaa       360
     ccttctttgt ctcgctctgc atcgttgctg aaatccaagc gtaacgagaa tggcccggca       420
     gtgttaaaga agaagctgag taagcgcaag gcgtacgaga ttgccagaga acgggaaata       480
     cggatgttgg cttctgctcc gatcgatatt cctcgtcgtc cctctccgct acccggggag       540
     cagttttcca ttgagacacg cagggctaat ggagcccaga gtcgacgctc cgatcggcac       600
     tgttctgaca ccagtctttc gatgcgtgac tctgctgcat cctcactctc ggatattttc       660
     gaatcctata cgttcaaggt caacactttt gctgcatgga cgcctcgtcc ggtcatacgc       720
     tatgtggaag ctcctcgggt gtcgacagct aagagtcaaa ggccgtctga gccttcaatt       780
     cggaaggata agacaccggc ttatgccacg cacaacgagc actcgcgttc taagaagaga       840
     gtagacaagc tagccgacga cttagatgcc ggtgccctca gggaattgct tgaaagggac       900
     cgccggcgta gggagcgcaa gcaacttgaa gatcaagcaa gacttcaccg gaagttacaa       960
     cgcgctgcgg aacaacagcg gcaagcagaa gcagaagccg aagccgatgc tgttccccaa      1020
     gaaccatcca gcgaggctga agacacatct ttagctccac gtggtcggcc tggcgcggag      1080
     agccgggctg tatctgatcg gtcaaaagaa tatgctcctc ggacaaacga aaccaatgcc      1140
     ttcctgggcg gtaattcttc tggatcttgg ctgagaggtg cttccaaaga cacagatcga      1200
     cgtggccgcg agtccgttga tagtgtgcat gtcattggta acatcgacga tagctccatt      1260
     cgggaaccga agcttgtgat gcgtcgtagc ttcgctccgt cgcaagacat gggaatgtct      1320
     ggcagcagtt tgtctcattc gccgtcgagg cgtgagctgt atagcccaac ttcttcgcaa      1380
     ctctatggca taggccgaga atccacatcc gatatttcgc gaaccataga ctcagaccgg      1440
     cgcttgtctg accatggcag cggacgtgtt aatacgctta cttctatttt ccgacgtggt      1500
     agctcgcgcc tcaaacgcag ctatcgtgaa cgtttccatg aacgcagtcc tgagcactcg      1560
     aacccgtctc atgaatcttt cttcaaggtc cagacgcagt cgtctggccc acctccctca      1620
     ttcgtcactg ctcctcggac attcctgggg tcaggtacca tcaagcggtc gcagtccaag      1680
     tttaccgaac acttcggtga cgagcccctt tctccaccgg actctaggct tcaatcacct      1740
     gatatcccag aggtgttgga tgagttcgag agagaagatg agatgtcaga tatcaacatg      1800
     gggacccagt atcccatccc cagttctggg tcagaacccc aggacatccc gagaaatcct      1860
     caccattctt ggacaggcga cagctgggaa ggtgacccgg acaatcttcc tttgtcccaa      1920
     tctctagcat cgattgactc cgaaggatca tggatgtcgg gacaattctt acgtcgcata      1980
     tctcagaaga aggcgagcaa tccactgcgc accagcctta gctcatcgcg aaacatcatg      2040
     gaagagggcc atgaggggtc ctccaatgga gatgacgttc cggttagcga acctcttgtc      2100
     agatttggga ccaatcagga tgagggtctc aaatccggcc ctgatgtagc tggtgcgtcg      2160
     cctgacaagg actcgcctat ggatagcgta ccggagcaag cagaggagac ctggcatgat      2220
     caaattgccc ggcgacctgt acttgtgact ccagcaatcc gtccgaagtc caacgaagga      2280
     ctcttgaaga atgtccagtc cttctgtgcc gaagaagaat tcagtcccat tgaagagcac      2340
     tctgctgagt ttgagctcga aacgtctgat aaccacggga atgggcgctc gaattga         2397
//

If you have problems or comments...

PBIL Back to PBIL home page