(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE238

ASPNC_1.PE238        Location/Qualifiers
FT   CDS_pept        join(complement(606296..606308),complement(606004..606214),
FT                   complement(605969..605973),complement(605868..605887))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876784"
FT                   /orf_name="An01g02520"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43621.1"
FT                   /db_xref="UniParc:UPI0000EF9EC7"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Z8"
FT                   /transl_table=1
FT                   /translation="MYGVKNITEKIKRPGGGFGLVPSGSAVTAGPGEGRRCVTTNQPTR
FT                   SPGSETGGFVCVSALSVPRSRLLTVLSTSDNRKTAAR"
     atgtatggag taaaaaatat aacggaaaaa atcaagcgtc ccggtggtgg atttggactg        60
     gttccaagtg gttctgctgt gacggccggc cccggggagg gtcgacggtg tgtaaccact       120
     aaccaaccga cgagatcccc tggttcagaa acgggcgggt ttgtttgtgt ctcggccctc       180
     tcagtccctc gctctcgact tttgaccgtt ttgtctacta gtgataatag aaaaaccgct       240
     gccagatag                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page