(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE239

ASPNC_1.PE239        Location/Qualifiers
FT   CDS_pept        join(complement(608170..608236),complement(608018..608070),
FT                   complement(607903..607995))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876785"
FT                   /orf_name="An01g02530"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43622.1"
FT                   /db_xref="UniParc:UPI0000EF9EC8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Z9"
FT                   /transl_table=1
FT                   /translation="MAVKIVNLLACGQRKLDGLGAGSDGGAQNGEKLANSRPMEVSKTL
FT                   LSTRLTPYDQPAVIPIGYRWSCTDP"
     atggctgtca aaattgtcaa tttattagct tgtggccagc ggaaattgga tgggctggga        60
     gcgggaagtg atggaggagc gcaaaatggt gaaaagttag ccaattccag accgatggag       120
     gtgagtaaga cattgctgag tactaggctt actccatacg atcaaccagc agtgatacct       180
     attggatacc gatggtcatg taccgatccc tag                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page