(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE24

ASPNC_1.PE24         Location/Qualifiers
FT   CDS_pept        join(60604..60655,61102..61610,61680..63410)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209860" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874690"
FT                   /orf_name="An01g00260"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK43418.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG329822"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000EF9EF4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7D4"
FT                   /transl_table=1
FT                   /translation="MKGQGYMDFDLSRSQESALLYRNPTMSTISSMPHSPTDASSPLQS
FT                   YARTCSSCRQRKVKCDRQRPCINCSRSGVECIYPPGRGRAPKRPRNAVNAQLSHRLTRL
FT                   ESIIRSFEYHQNQESSTHPPAAPVALSSRAGSRASETSRIQSVPRTSNSDSENSIEQHL
FT                   GRLLIDDTRSYYVSNVLWANLGDEIAELRDLLHEPLVEEDSAFLEEPVPERPLPTGSNA
FT                   AILGFRALAHSLHPYHPPLTESVTLFGVFQENVSPMVRIFHMPTLARNYWDAVASLESL
FT                   DKDTEALLFAIYYSAVISMEPEQCLRTIGVSKAHASETYLFAVEQALARADLLNTQSVT
FT                   LLQAAVLFLFALRNEDDSRTVWSLTALIFHIAQAMGLHRDGVVFGLKPMETELRRRLWW
FT                   HICLLDARSSEYHGCEPIVRDSAFDTKLPLNVEDADLTADMSELPTERTGVTGMYFCLI
FT                   RCEVMRTMWKLSCVAPGLGGSRLGTGRPSLKEREALVQNLHDRLEERYLQHCDISQPFG
FT                   LASTFVARLMVARAWLVARYLLDEKEHGDNLSGPVRDQLFMSSIEVLELSSLVLTNKAI
FT                   AHWSWHSKTHIQWHAVAFVLSEICTRPPSADCDRAWQYVNTVYNNWKMKESGRKGTLWR
FT                   PIRRLMAKAQYIREMQELDPAGRGRQRAPPNRDSMQGVLGPEMCWGTNAAYVSTPVDTA
FT                   CNVVGALPSEILAGTLDPFEELFPGAPHVESSAHEPCDNIGPMLPLYDDSHIPEWLVPE
FT                   WIRNPPGNGE"
     atgaagggtc aaggatatat ggattttgat ctatctagat ctcaagagag tgcgctgctt        60
     tacagaaatc ctacgatgag caccatatcg tcaatgccac atagtccgac tgatgcttcc       120
     tctccacttc agtcttacgc ccgcacttgc tcttcttgtc gacagcgaaa ggtaaaatgt       180
     gaccgccaac ggccttgtat caactgcagc cgctcgggcg tggaatgtat ctatcccccc       240
     ggacgcggca gggctcctaa gcggccccgc aatgccgtga acgcgcagtt gtcgcaccga       300
     ttaaccagac tcgagtctat cataaggagc ttcgagtatc atcagaacca ggaaagctca       360
     actcatccac ctgcagcgcc agtcgcccta tcgtcccgag caggcagcag agcgtcagag       420
     acttcccgta tccaatctgt cccccgcacg agcaattcag actcagaaaa ttccattgag       480
     cagcatctag gccgcttgct gatagatgat acacggagct actatgtcag taacgtcctc       540
     tgggcgaatc tgggtgatga gattgcagag ctgcgggatc tactacatga gcccttggtt       600
     gaagaggatt ctgccttttt ggaggagccc gttccggagc gacctttgcc tacgggctca       660
     aatgctgcaa tattaggttt tcgggctctt gctcattcac ttcatcccta ccatccaccc       720
     ttgactgagt cggtgaccct cttcggggta ttccaagaga acgtctctcc gatggtacgt       780
     atcttccata tgcccacgtt agctcgtaat tattgggatg cggttgcgtc tctcgaatcg       840
     cttgataagg ataccgaagc cctcttattc gccatatatt actctgcagt aataagcatg       900
     gagcccgagc aatgcttaag aactattggc gtctccaagg cacatgcttc agaaacctat       960
     cttttcgccg tggaacaggc cttggctcgt gctgacctgc tgaatacgca aagcgtcacg      1020
     ctattgcaag ccgccgtgct tttccttttc gcgctacgca acgaagatga ctcccggacc      1080
     gtctggtctc tcacagcact catctttcac atcgcacaag ccatgggtct ccaccgtgat      1140
     ggcgtcgtgt ttgggcttaa gcctatggag acagagctac gccggcggtt gtggtggcac      1200
     atttgtctcc tagatgctcg ctcatcagag taccacggct gcgagccgat tgtgcgggac      1260
     tcagcctttg acacgaagct accactcaat gttgaagatg ctgacctgac tgccgacatg      1320
     agcgagctac caactgagcg gaccggtgta accggcatgt atttctgtct tattaggtgt      1380
     gaggtcatgc ggaccatgtg gaagcttagc tgtgtggctc ccggcttggg aggttcgaga      1440
     cttgggactg gcagaccatc tctgaaagaa cgtgaagctt tagtgcagaa tctgcacgat      1500
     cgccttgaag agcgatattt gcagcactgt gatatctcgc agccttttgg cttggcttca      1560
     acattcgtag cccgtctaat ggttgcacgc gcgtggctcg ttgcacgata tcttttagat      1620
     gagaaagaac atggtgacaa tttatcgggc cctgtgcgcg atcaactctt catgtcatct      1680
     attgaggttc tggagttatc cagcttagtc ctcactaaca aggccattgc tcactggagt      1740
     tggcactcaa agacacacat ccaatggcat gcagttgcct ttgtgctctc tgagatctgc      1800
     acccggcccc cttcggcaga ctgtgaccgc gcatggcagt acgtcaatac cgtctacaac      1860
     aattggaaga tgaaggaaag cgggagaaag ggtacgctat ggcggcctat tagacgactg      1920
     atggccaagg cacagtacat acgagagatg caggagctag accctgccgg tagagggaga      1980
     cagagagcgc cgccaaaccg agatagtatg caaggggttc taggccccga gatgtgctgg      2040
     ggtacgaacg cggcatatgt gtctacacct gtcgacacag cctgtaatgt ggtaggagct      2100
     ctgcccagcg aaatcttggc ggggactttg gatcccttcg aagagctttt ccccggtgct      2160
     ccgcacgttg agagctccgc acatgaaccg tgcgacaata tagggccaat gctccctctt      2220
     tatgatgact cccatattcc tgagtggctg gttccggagt ggatcaggaa tccaccgggc      2280
     aatggggaat ga                                                          2292
//

If you have problems or comments...

PBIL Back to PBIL home page