(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE244

ASPNC_1.PE244        Location/Qualifiers
FT   CDS_pept        complement(614462..614635)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876789"
FT                   /orf_name="An01g02590"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43627.1"
FT                   /db_xref="UniParc:UPI0000EF9ECD"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q804"
FT                   /transl_table=1
FT                   /translation="MEDIITTGSGSNDRMQQQQRGGGQSSRASPVLCVLAGLASLKGGQ
FT                   LVTCWYSDLNHG"
     atggaggata taataacgac ggggtcaggg agtaatgatc ggatgcagca gcagcaacgc        60
     ggcggtggtc agtcgtcgag agcctcgccc gtcctttgcg tgttggccgg cttggcatcc       120
     ctcaagggcg gccagctcgt cacgtgctgg tacagtgatc ttaatcacgg atag             174
//

If you have problems or comments...

PBIL Back to PBIL home page