(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE245

ASPNC_1.PE245        Location/Qualifiers
FT   CDS_pept        join(614759..614780,614879..615002,615065..615253,
FT                   615305..617420,617475..617570)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210271" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654012"
FT                   /orf_name="An01g02600"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="Golgi apparatus part"
FT                   /cellular_component="clathrin adaptor complex"
FT                   /protein_id="CAK43628.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030131"
FT                   /db_xref="GO:0044431"
FT                   /db_xref="HOGENOM:HBG604608"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR008153"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017107"
FT                   /db_xref="UniParc:UPI0000EF9ECE"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q805"
FT                   /transl_table=1
FT                   /translation="MASRRCPFKQFIRNVRSAKTIADERAVIQKESAAIRASFREESHD
FT                   SGIRRNNVAKLLYLFTLGERTHFGQIECLKLLASHRFADKRLGYLGTMLLLDENQEVLT
FT                   LVTNSLKNDLNHSNQYIVGLALCALGNIASVEMSRDLFPEVENLMSTANPYIRRKAALC
FT                   AMRVCRKVPDLQEHFLEKAKTLLSDRNHGVLLCGLTLAIDMCEAEEAEEGQEGVIEMFR
FT                   PLAGGLVRSLKGLTTSGYAPEHDVSGITDPFLQVKILRLLRVLGRGDAATSEMINDILA
FT                   QVATNTDSTKNVGNAILYEAVLTILDIEADSGLRVLGVNILGKFLTNKDNNIRYVALNT
FT                   LNKVVAIEPNAVQRHRNTILECLRDPDISIRRRALDLSFMLINESNVRVLVRELLAFLE
FT                   VADNEFKPAMTTQIGIAADRYAPNKRWHVDTILRVLKLAGAYVKEQILSSFVRLIATTP
FT                   ELQTYSVQKLYLSLKEDISQEGLTLAATWVIGEYGDNLLQGGQYEEEELVKEVKESDIV
FT                   DLFTNILNSTYATQTVVEYITTASMKLTVRMSDPAQVERLRRFLSSRTADLSVEIQQRA
FT                   VEYVNLFGYDQIRRGVLERMPPPEIREEQRVLGAPTKKRQSKILKDKSKKPAKQAEQDM
FT                   LLDLMGGDAPPTSPTTNGSQNTADLLADILGGDSSLSSPSPQPAQKAAGSTNTSAIMDL
FT                   FNTNGSTPSPKPAEPASSGLDLLAGLSSSASPAPTPAPSATPAHTAFNKNDLSLALQVQ
FT                   RGSGGSAQIQARFRNNSSFGRFSNVGLQAAVPKSQKLQLSAINKADLDAGDEGIQMLKV
FT                   AALTGALPPKLRLRLRITYAKDGSDPVTDQVDWTEP"
     atggcatccc gtaggtgtcc tttcaagcag tttatccgga acgtgcgttc ggccaagaca        60
     atcgccgatg aacgagcagt catccaaaag gagagtgcgg ccatccgtgc gtcgtttagg       120
     gaagagagcc atgattcggg catccggaga aacaatgtgg ctaagcttct gtatttattc       180
     accctcggtg aacggacaca ctttggtcaa atcgaatgtc tgaagctact ggcctcccac       240
     cgtttcgccg acaagcgcct gggatacttg gggacgatgc tgttactgga tgagaaccaa       300
     gaagttttga cgctggtaac aaactcattg aagaatgacc ttaatcactc caaccaatat       360
     atcgtcggct tggccctgtg cgccctgggc aatatcgcct ccgtcgaaat gtctcgagac       420
     cttttccccg aagtcgaaaa cctaatgtct actgcaaatc cctatattcg gaggaaggcg       480
     gcactgtgtg ctatgcgtgt atgtcgcaag gttcccgacc tgcaggagca tttcctggag       540
     aaggcaaaga ctcttctgtc agacaggaac catggtgttc tgctgtgcgg tttaacactc       600
     gcgattgaca tgtgtgaagc tgaggaggcg gaagaaggcc aggagggggt gatcgagatg       660
     ttccggccgt tggccggtgg tcttgtgcgc tccctaaagg ggttgaccac ctcgggatac       720
     gctcccgaac atgatgtctc cggtatcacc gatcccttcc tccaagtgaa gatactgcgc       780
     cttctcagag tactaggaag aggggatgcg gcgaccagcg aaatgatcaa cgacattctg       840
     gcccaggtgg ccactaacac ggattcgacg aagaacgtcg gcaacgctat tctctacgag       900
     gctgtcctga ccattctcga catcgaagct gattcaggat tgagagtgct aggtgttaac       960
     attcttggaa agttcctgac caacaaggac aacaatattc gttacgttgc tctcaacacg      1020
     ctgaacaaag ttgttgcaat tgagcccaat gccgtccagc ggcaccgcaa caccattctg      1080
     gagtgtctcc gtgacccgga tatcagtata agaagacgtg cccttgatct cagcttcatg      1140
     ttgatcaatg agagtaatgt gcgtgttctt gttcgagagc tgctcgcttt cctggaagtt      1200
     gccgacaacg agttcaagcc agccatgacg actcaaattg gtatcgctgc tgaccgatat      1260
     gcccccaaca aacgctggca cgttgacact attctgcgag tactcaagct tgctggtgcc      1320
     tatgttaagg agcagatact ctcgtccttt gttcgcctca tagccaccac accagagctg      1380
     cagacctact cggtgcagaa gctttatctc tcattgaaag aagacatctc ccaagaaggc      1440
     cttacccttg ctgctacctg ggtcattggc gagtacggtg ataaccttct ccaaggtggt      1500
     caatatgagg aagaggagct agttaaagag gtcaaagaga gcgacatcgt tgacctgttc      1560
     accaacatcc tcaatagcac atacgccacg caaacagtgg tggaatacat cactacggcc      1620
     tctatgaagc ttaccgtgcg catgtctgat ccagcacagg ttgagcggct ccgtcgcttc      1680
     ctcagcagcc ggactgccga cctgagtgtt gagattcaac agcgggctgt cgagtacgtc      1740
     aacctgttcg gctatgacca gattcgtcgt ggagttctcg aacgcatgcc cccgcctgag      1800
     atacgtgaag aacaaagagt cttgggtgca ccgaccaaga agcgtcaaag caaaatcctg      1860
     aaagacaaat ccaagaagcc tgccaagcag gctgagcagg acatgctcct ggacctcatg      1920
     ggcggcgatg ctccaccgac cagcccgact accaacggtt cccaaaatac ggctgatctc      1980
     ttggccgata tcctcggcgg cgattccagc ttatcgtcac cttctcccca acctgcgcag      2040
     aaggcagcag gatccaccaa taccagcgct atcatggact tgttcaacac taatggaagc      2100
     acgccctctc ccaaacctgc ggagcctgca tcttcaggct tggatcttct agcaggcttg      2160
     agctcttctg cctcgcccgc acccactcct gcgccgtcgg cgactcctgc tcatacggcc      2220
     tttaacaaga acgacctctc ccttgccctt caagtccaac gtggtagcgg tggaagtgcg      2280
     cagattcagg ctcgtttccg caacaattca agctttggcc gcttctccaa tgttggattg      2340
     caagcagccg tgcccaagag tcagaaacta cagctaagcg cgatcaacaa ggctgatctc      2400
     gatgctggcg acgaaggtat ccagatgctc aaagttgcag cactaactgg ggccctccca      2460
     cctaagctcc gccttcgtct ccgtatcacg tatgccaagg atggctctga tcctgtaaca      2520
     gaccaggtag actggaccga gccgtga                                          2547
//

If you have problems or comments...

PBIL Back to PBIL home page