(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE247

ASPNC_1.PE247        Location/Qualifiers
FT   CDS_pept        join(621072..621231,621613..621723,621789..621916,
FT                   622013..622270)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211832" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876791"
FT                   /orf_name="An01g02620"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK43630.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG748799"
FT                   /db_xref="InterPro:IPR003956"
FT                   /db_xref="InterPro:IPR003957"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI0000EF9ED0"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q807"
FT                   /transl_table=1
FT                   /translation="MSSTSPSKEPEVEPEVQSGEDQEQMDKEQQDTQAQGQGEFEVKEQ
FT                   DRWLPIANVARIMKLALPENAKIAKEAKECMQECVSEFISFITSEASEKCQQEKRKTVN
FT                   GEDILFAMTSLGFENYAEALKIYLSKYRETQSARGEHQNRPTSSGYGAGAPVGAPGPAG
FT                   PGGRPMAPGAGFPDAADSANNIMNQSLDPSEQDTSAYGYPPMVGQPHNGTAGESY"
     atgtcgtcga cctctccctc gaaggaaccg gaggtggaac ccgaagttca atcgggtgaa        60
     gaccaggaac aaatggataa ggaacaacaa gacactcagg cgcagggtca gggagagttc       120
     gaggtgaagg agcaggatag atggctacca attgcaaatg tggcccgcat catgaagctg       180
     gctttgcctg aaaatgccaa aatcgcaaag gaggccaagg agtgtatgca agagtgtgtg       240
     agcgagttta tctcattcat cactagcgaa gcctccgaga aatgccagca agaaaagcgc       300
     aagaccgtta acggggagga cattctattc gccatgacct ccctcggctt tgaaaactat       360
     gcagaggccc ttaagattta cctgtccaag tatcgcgaga cccaatccgc cagaggcgag       420
     caccagaacc gtccaacaag cagtggatat ggtgctggcg cgcccgtagg ggccccggga       480
     cctgccggtc ctggtggccg tccaatggca ccaggtgcag ggtttcctga tgctgctgac       540
     agcgccaaca atatcatgaa ccaaagcttg gacccgtctg agcaggacac ttccgcttat       600
     ggctaccccc cgatggtcgg ccagccgcac aacggcaccg ctggtgaatc ttattag          657
//

If you have problems or comments...

PBIL Back to PBIL home page