(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE251

ASPNC_1.PE251        Location/Qualifiers
FT   CDS_pept        join(630725..630895,631054..631349,631403..631647,
FT                   631707..631737,631815..632175)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876793"
FT                   /orf_name="An01g02660"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An03g05810 - Aspergillus niger"
FT                   /protein_id="CAK43634.1"
FT                   /db_xref="UniParc:UPI0000EF9ED4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q811"
FT                   /transl_table=1
FT                   /translation="MTAVSSEYAHQTKGPRILAVFWTMTSLAILAVAARLFIRIKVLRN
FT                   PGADDWLIATSMTRTRSASQLYQLRLGHNLLRLTQISRGCPAEPFSESDNDTTRDLMGI
FT                   DGVCGTGVVYLHLGALYHVRSSESSLGHVPSVKGRELPELVDPCGLCHLHWSHICLYGS
FT                   VFGNLSDSHLTKASYVDAETIGVVCSAGSECSVSKNSRSSSSSVLAKKQGYSACAMAII
FT                   KCMQLPGLADLSDTTYATADLVIWTSIESNVVILASCIPTLQPLLEIILGKRSLRSTGG
FT                   YQYKESSTQLPESNKWSSKRSGHRKSKGNMMIADIGSQDSILQIGDDHEDESHYMGHIR
FT                   RTDKITVVYESVTPQPGGGDKTNDPVK"
     atgactgctg tatcttcgga atatgcccac cagactaagg gcccacgaat attggctgtc        60
     ttttggacca tgactagtct tgcaattcta gctgtggcag ccaggctctt catccgtatc       120
     aaagtcttgc gcaacccagg tgcagacgac tggttgatcg caacgtcaat gactagaact       180
     cgttctgcta gtcaactata tcaacttcgc cttgggcata atctccttcg ccttacccaa       240
     attagccgtg gctgccctgc tgagccgttt tctgaatccg acaacgatac aacgcgcgat       300
     ttaatgggga ttgacggggt ttgtggcact ggtgtcgtgt atttgcatct tggtgctctt       360
     taccatgtgc gatccagcga aagctctttg ggacacgtcc cttctgtcaa agggcgcgag       420
     ttgccggagc tcgtggatcc ttgtggacta tgccatcttc actggagcca tatctgcctt       480
     tacggatctg tatttggcaa tttatccgac agtcatctta ctaaagcttc atatgtcgat       540
     gcggaaacga ttggcgttgt gtgcagcgct gggtctgagt gcagtgtaag caagaactca       600
     agaagctcat cgtcatcagt attagctaag aaacaaggct atagcgcttg tgcaatggca       660
     atcatcaagt gcatgcagct accaggtctt gccgatctca gcgatacgac atatgccacg       720
     gccgaccttg tgatatggac aagtatcgaa tcaaacgtcg tgatcctagc ctcatgtatc       780
     cccacgctac aaccgcttct cgaaataatt ctcggaaagc gcagtctgag aagtaccggc       840
     ggatatcagt acaaagagag cagtacccaa ttgcccgagt ctaacaagtg gagcagcaag       900
     cgatctggac accggaaaag taaaggcaat atgatgattg cagacattgg cagccaggat       960
     agcatcttgc agataggtga tgatcacgag gacgaaagcc attatatggg gcacatccgt      1020
     cgtacagata aaatcactgt tgtgtacgaa agtgtgacac cacagccagg tggtggtgat      1080
     aaaacaaatg accctgtaaa atag                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page