(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE252

ASPNC_1.PE252        Location/Qualifiers
FT   CDS_pept        join(complement(633514..633703),complement(632522..633483))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211800" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876794"
FT                   /orf_name="An01g02670"
FT                   /product="Function: the S. pombe scn1 protein interact with
FT                   the CUT9 protein"
FT                   /function="endodeoxyribonuclease activity, producing 5'-
FT                   phosphomonoesters"
FT                   /protein_id="CAK43635.1"
FT                   /db_xref="GO:0016888"
FT                   /db_xref="HOGENOM:HBG329832"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="UniParc:UPI0000EF9ED5"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q812"
FT                   /transl_table=1
FT                   /translation="MSETDQNDAFPWHLGVFDAHCHPTDTMSSIAEIPQMKVLTLTVMS
FT                   TRGEDQDLVLQTATSLTQGPVLPCFGWHPWFSHQIIDDTTGSPKTDESTSPIELKKLHY
FT                   KKVLTPEPDDDFILSLPDPKPLSELLSESRARLLAYPRSLVGEVGLDRAFRLPKAWTEE
FT                   EKETRDERMTPGSREGRQLSPYRVQLAHQKAVLEAQLRLAGELQRPVSVHSVQAHGAVF
FT                   DLLKALWSGHERKNASRRERRRRYSVPDAHAESDAEDERMQQKPAKSDEKSLPFPPRIC
FT                   MHSYSGPVEPLKQFLHQSNPSDVYFSFSSVINFGGPSSQKVINVIKALPDDRILIESDL
FT                   HTAGQQMDDLLEEIARQICNIRGWELHQGVRQLAENWKRFVLG"
     atgtctgaga cggatcagaa cgatgcattt ccttggcact tgggggtgtt cgacgcccat        60
     tgtcacccca ctgacaccat gtcatccatt gcggaaatcc cccaaatgaa agtattgaca       120
     ttaacagtca tgtccactcg cggggaggac caggacttgg tgcttcagac cgctacatcc       180
     ttgacccagg ggcctgtgct accgtgcttt ggctggcacc catggttctc gcatcaaatc       240
     atcgacgata cgactggttc gcccaagacc gatgaaagta cctcaccaat tgagctgaag       300
     aagctgcact ataagaaggt ccttactcca gagccagatg atgacttcat cctgtcgtta       360
     cctgatccaa agccgctgtc agagttgctg tcggaatctc gagcacggtt gctggcgtat       420
     cctcgttctc ttgtgggtga ggttggcctt gatcgtgcgt ttaggcttcc caaggcgtgg       480
     accgaggagg aaaaagaaac tcgggatgag cgaatgaccc ctggatctcg ggaaggtaga       540
     cagctttcgc cgtatcgtgt tcagttggcg catcaaaaag ccgtcttgga ggctcagttg       600
     cggctagctg gggaacttca gcggccagtt tctgtgcata gcgttcaagc tcatggggcg       660
     gtctttgacc ttttgaaggc cctttggtct ggccatgagc gaaagaacgc ctcacgacgg       720
     gagagacgcc gacgttatag tgttccagat gcgcatgcag agagcgatgc ggaggatgaa       780
     cgaatgcaac agaagcctgc aaagtcagat gaaaagtctc tcccattccc accacggatc       840
     tgcatgcatt cttattccgg gccggtggag ccattgaagc aatttctgca tcaatctaat       900
     ccgtcagacg tctacttctc cttctcttct gtgataaact tcggcggacc ttcgtcacag       960
     aaggtcatca acgttatcaa ggctttgcct gatgatagaa tactcatcga gagcgatctg      1020
     catacggctg ggcaacagat ggatgacttg ctggaggaaa ttgctaggca gatctgcaat      1080
     atccgcgggt gggagttaca tcaaggcgtt cggcagctcg ctgaaaactg gaagaggttc      1140
     gttcttggat ga                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page