(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE259

ASPNC_1.PE259        Location/Qualifiers
FT   CDS_pept        join(649696..649739,649792..650197,650247..650372)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876800"
FT                   /orf_name="An01g02750"
FT                   /product="Similarity to hypothetical protein CAC28656.1 -
FT                   Neurospora crassa"
FT                   /protein_id="CAK43642.1"
FT                   /db_xref="InterPro:IPR014851"
FT                   /db_xref="UniParc:UPI0000EF9EFC"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q819"
FT                   /transl_table=1
FT                   /translation="MFVRIDLLCQESDVLFLFRFNHTPSSLNHSSPWMHVEDNTHLTLQ
FT                   CLSLSLSPLKAFLKEVRTYPRKVSESTISIYRTQSTPRDIHWMPVATRLPRDISTIILN
FT                   ENKKQKILQDITEYLHPQGRQRWRSRRSGEAEDRRREGETAGACGRGFLLQYKREPEKA
FT                   CENVAGWVEEDLGVDDEQTTNTEEDRDK"
     atgtttgtgc ggattgatct actttgccag gaatcagacg tgctctttct ttttcgcttc        60
     aaccatacac ccagcagtct caaccactcc tccccctgga tgcacgttga agacaacacc       120
     cacttaaccc tacaatgtct cagcctatcc ctctcaccac tcaaggcctt cctcaaagaa       180
     gtccgtacct atcctcgcaa ggtctccgaa tccaccatct caatctaccg cacgcaatcc       240
     acacctcgag atatccactg gatgcccgtc gccactcgcc taccccggga catctccacc       300
     atcatcctga acgagaacaa gaaacagaag attctccagg atataaccga gtacctacac       360
     cctcagggca gacagcggtg gcgatccagg cgatcaggag aagcagaaga tagaagacga       420
     gaaggagaaa ctgcaggagc ttgcggacgg gggttcctgt tgcagtataa acgggagcct       480
     gagaaggcat gtgagaatgt tgctggttgg gttgaggagg atttgggcgt cgatgatgaa       540
     caaactacta atactgagga ggaccgtgac aaatag                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page