(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE265

ASPNC_1.PE265        Location/Qualifiers
FT   CDS_pept        join(665173..665272,665452..665661,665745..665779,
FT                   665860..665901)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806679"
FT                   /orf_name="An01g02820"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43648.1"
FT                   /db_xref="UniParc:UPI0000EF9F02"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q825"
FT                   /transl_table=1
FT                   /translation="MVEAYGNLHSRIISDCAVSCFHDQVVVICSSPLSHFLETLGHATS
FT                   HTVGTYNGLLEVQVTRDRETGKLITTCEHRVLGSSQGTLFTSKIDLGALLYDRVGETHD
FT                   SVAIPGPAEIAQSADLAFEIIGSW"
     atggtggagg cctatggtaa tctacatagt cgcatcatat ctgactgcgc ggtttcttgc        60
     tttcatgatc aggtggtggt tatttgttcg agtccgttga gtcacttcct agagacgctc       120
     ggacacgcaa ccagtcatac tgtgggaaca tataatggac ttctcgaagt tcaggttact       180
     agagatcgtg aaactgggaa gctaatcacc acctgtgagc atagagttct tggctctagc       240
     cagggaacac tctttacttc caagattgac ttaggagcct tattatatga tcgcgtggga       300
     gaaacacacg attctgtggc tataccaggc cctgcggaaa ttgctcaatc tgcagactta       360
     gcattcgaaa taatcgggtc atggtag                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page