(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE266

ASPNC_1.PE266        Location/Qualifiers
FT   CDS_pept        join(666258..666545,666601..666978)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211734" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876804"
FT                   /orf_name="An01g02830"
FT                   /product="Similarity to heat shock protein 67B2 -Drosophila
FT                   melanogaster"
FT                   /biological_process="response to stress"
FT                   /protein_id="CAK43649.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG329843"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI0000EF9F03"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q826"
FT                   /transl_table=1
FT                   /translation="MASLLPLRRAPTSLLSSTSKQSTLLVRSLRASTTIPSTRTFTTRS
FT                   STLLPNTITKRTTITPISRPHHHLLISSTSIRQKSTKDNDAPTFRQWGFEDINASLPNS
FT                   PTEKPIILIDVREPAELSSTGIIPSAVSVPLASQPDALFLTPEEFETRFGFPKPGVKGD
FT                   EEGAEIVFYCKAGVRARAAAQLAEQAGYEASRLGVYDGSWLDWAKKGGRVERWEGNDN"
     atggcctctc tcctccccct ccgccgggca cccacgtccc tcctctcctc cacctccaaa        60
     caatctaccc tcctcgtccg ctccctccga gccagcacca ccatcccctc cacccggacc       120
     ttcacaacaa gatcctccac cctcctcccc aacaccatca ccaagagaac caccattacc       180
     cccatttctc gccctcatca ccacctcctg atctcctcca cttccatccg ccaaaaaagc       240
     accaaggaca acgatgcccc caccttccgc caatggggct ttgaagacat aaacgcttcc       300
     ctccccaaca gcccgactga aaagcccatc attttaatcg acgtgcgcga gcccgccgag       360
     ctctcctcca ccggcatcat cccctcggct gtgagcgtgc cgctcgcctc tcaaccggac       420
     gcactcttcc tgactccgga ggaattcgag acgaggttcg ggttccccaa gcctggtgtg       480
     aagggggatg aggagggtgc cgagattgtg ttttattgta aggcgggggt gagggcgcgc       540
     gccgcggcgc agttggcgga gcaggcgggg tatgaggcaa gtaggctggg ggtttatgat       600
     gggagttggt tggattgggc gaagaagggg ggtagggtgg agaggtggga ggggaatgat       660
     aattaa                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page