(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE274

ASPNC_1.PE274        Location/Qualifiers
FT   CDS_pept        join(685681..686547,686600..686894,686949..687769)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211679" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959931"
FT                   /orf_name="An01g02910"
FT                   /product="Similarity to hypothetical ARE1-like protein
FT                   F3I17.5 - Arabidopsis thaliana"
FT                   /protein_id="CAK43657.1"
FT                   /db_xref="HOGENOM:HBG323876"
FT                   /db_xref="InterPro:IPR007258"
FT                   /db_xref="UniParc:UPI0000EF9F2D"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q834"
FT                   /transl_table=1
FT                   /translation="MWLDRISGHATPSGPQFDSRSSSPLPRRTSSRLAPTPQNNRPASS
FT                   RQGSALSLLSTPNDSSTSLSAPARGEGSSPKPSATRPRPSDVADPLEVLNGIIGKQGKT
FT                   RDSSPASVAELKPPELVEDIDFHGLSLEDFIAEEDQPRRAWQSDVGAQTIQQFEKERDK
FT                   FQDLHSAITGCDDVSKSVEMYLNDFQNELGAVSAEIESLQSRSIQLNAMLENRRNVEQL
FT                   LGPAVEEISLSPKTVRLVAEGPIDENWVKALNEIETRTASIEAKASGTNSSKSIEDVRP
FT                   LLGDIKKKAVERIRDYLVSQIRALRSPNINAQIIQQQRLVKFKDLYGYISRAHPTLTGE
FT                   ITQAYINTMRWYYLSHFTRYHQALEKIKVYPSDRNEVLGGDPTSHKTGNIVPGGRAGSA
FT                   AHDPFSLGRRVDILRAGNQMAISSYLAEEDNAFHGLEIPFRNFNLALLDNVSAEYSFMT
FT                   EMFSTLGFQQISRKAVEIFEPVFTLGQTLTKHLIEQTTDALGVLICVRLNQQAAFELQR
FT                   RKVPVADSYVNGTNMQLWPRFQVIMDTQCESLKRVAANTGRSAVSALSLAGGDDLNKSS
FT                   APHFLTQRFGQLLHGILVLSSEAGDDEPVSNSLGRLTTEFDNLLTKLSRIGGDAKRRER
FT                   FLYNNYSLVLAIISVSRSIRRGYWC"
     atgtggctag accgcatttc gggccatgcg acgccctccg gtccccaatt cgatagtcgc        60
     agcagctctc ccttgcctcg aaggacctct tctcgcttgg ctccaacccc tcagaacaat       120
     cgccccgcgt ctagtcgcca aggttcagcg ttgtctctct tgtcgacccc gaatgattcg       180
     tctacctccc tctctgcgcc tgcgcgaggc gaaggatcct cgccaaaacc gagtgctaca       240
     agaccccgcc catccgatgt cgctgatccg ctcgaagtct tgaatgggat cattgggaaa       300
     caaggcaaaa caagagacag ctctccagcg tccgtcgcgg aactgaaacc cccggagctc       360
     gtggaagaca ttgattttca tggactcagc ctggaggact ttatcgcgga agaagaccaa       420
     ccgcgaagag cttggcaaag cgatgtcggt gcccagacca tccagcaatt tgagaaagaa       480
     agggacaaat tccaggacct gcactcggca atcactggct gcgatgacgt ctccaagtca       540
     gttgaaatgt atttgaatga ctttcagaat gaattgggag ctgtatcggc agaaattgag       600
     agtttgcaat ctcggtctat acagctgaat gcgatgctcg agaatcggcg gaatgttgaa       660
     cagctgcttg gtcctgccgt ggaagaaatc agtttgtctc cgaagaccgt ccggttagtg       720
     gcggaggggc ctattgatga gaactgggtc aaggccttga atgagattga aactcggacg       780
     gctagcatcg aggccaaggc ctcaggcacc aatagtagca agtctatcga agatgtgcgg       840
     cctttactgg gtgatatcaa gaaaaaggca gtggaacgaa tcagggacta cctggtctct       900
     caaattcgag ccctacgatc tccgaatatc aatgcgcaga tcatccaaca gcagcgacta       960
     gtcaaattta aggacttgta cggctacata tcacgagccc acccaactct tacgggagaa      1020
     atcacccagg cgtacatcaa tacgatgcga tggtattacc tgtcgcattt cacaaggtat      1080
     caccaagcac tcgagaagat caaggtctat ccgagtgatc ggaacgaggt attaggaggg      1140
     gacccaacct cacataaaac aggtaatatc gttcccggcg gccgagctgg ttctgcggcg      1200
     cacgacccct tctctctcgg caggagagtc gacatactta gggcgggtaa ccaaatggcg      1260
     atatcttcct acttggcaga ggaggacaat gctttccacg ggctcgaaat tcccttccgt      1320
     aacttcaacc ttgctctcct agacaacgtt tccgccgaat actcatttat gaccgagatg      1380
     ttctccacat tgggctttca acaaatatct cgcaaggctg ttgagatctt cgaaccagtc      1440
     ttcacccttg ggcagaccct gaccaagcac ctgatcgaac agactacgga tgcgcttgga      1500
     gttctgatct gcgtgcggtt gaaccagcaa gccgcttttg aattgcagcg gcgcaaggtg      1560
     ccagtggccg actcatatgt caacggaacc aacatgcaat tgtggcctcg gttccaggtc      1620
     atcatggaca cgcagtgcga gtccctgaag cgggtagcag caaacaccgg ccgtagtgca      1680
     gtttctgcgt tgtctcttgc cggaggagac gacctcaaca agtcatccgc acctcatttc      1740
     ctcactcaac ggtttggaca gcttctgcac ggcattttgg tgctgagcag tgaggctggg      1800
     gatgatgagc cggtttccaa tagtctgggt cggttgacca cagagtttga caaccttctg      1860
     acgaagctca gccggattgg cggcgacgcc aaacggaggg agaggtttct ttacaataat      1920
     tactcacttg ttctggctat tattagtgta agtcgatcga tccgccgcgg atactggtgc      1980
     tga                                                                    1983
//

If you have problems or comments...

PBIL Back to PBIL home page