(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE277

ASPNC_1.PE277        Location/Qualifiers
FT   CDS_pept        join(complement(694162..694237),complement(694059..694113),
FT                   complement(692920..693991),complement(692751..692873),
FT                   complement(692655..692705),complement(692483..692607),
FT                   complement(691397..692438))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211655" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959932"
FT                   /orf_name="An01g02940"
FT                   /product="Similarity is restricted to the C2H2-type zinc
FT                   finger motif"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK43660.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG323877"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0000EF9F30"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q837"
FT                   /transl_table=1
FT                   /translation="MVLRKCTICDRRFKKTEHFKRHERSHTKEKPYECNVCHKRFSRSD
FT                   VLSRHARGHNQPAANAAVRPGAGLPATPTNQAPADRSSTMTADTQNYVLGIGAESARPL
FT                   QHGSSAPHNSAFSAALDQQSTSLDFLANVSAHQPRTEPIANQVMASEHQEYLGWNDVPV
FT                   PDQQCYRGTMLDPLHNDILQFWLEPQGDSISQQGSIDLGGNSNLGMLGGAVASSESRPS
FT                   IGSMSLSSGGSIPIERFARVQRYWLAPSNNTGRLMNSLWHDIAYSEEDNVFALRPTHSS
FT                   SGPSGYMQGSRYGVDEECRQRLYTIFSQSRGQFQMRSSESTAVSPFTQPPRNNSNFPPA
FT                   EILDMALDLFFRDFHPLVPFIHVPTFSAKDARPSLLYAMCLIGMVLLGTKGTLNFVVNN
FT                   FSSMLESVTADLSKCSVGVEGSLSTVSTFAAAFLFLNLAAMTGEKEHLVKCQMLYVNLI
FT                   SIAQRHGLFAAREGQVLGANLFDAIPNTETRWKAWSKVESVKRLITGLLLLDSWYSSFM
FT                   STSPIIVPDSVQMILPCEEALFRATSSTRWMQLSDSDKVRLMPTILMPSENVDVPTLHS
FT                   PVDDFCMYAVLAMVQSRLSEAYYRLLSNRASYPFAPCNTYAMDGRARCLPSLQLQLTSK
FT                   YGDVLDRLNPNAAVMWHNMCMTLTADTQIFDMAAGRSGPGPARKALDDIAAWSQTPAAR
FT                   RACLHAAHIYRAMTNRRASDHTMFHSVFSLFYAALVLGLYVFMVPNPSEMQRGGNSIEL
FT                   FDDIDWQKVGTEGFTSFMEPRKGQPFPPSEEPALEFIKNGGTVYLRGVPIQGGYQAARR
FT                   ILLDYAGLLKDTGKWSVRKFSYVLHIMSDVLMDVE"
     atggtattgc gaaagtgtac catatgcgat cgacgtttca agaaaacgga gcatttcaag        60
     cgccacgaac gctcacatac taaagagaag ccctatgaat gtaatgtctg tcataagcgt       120
     ttctcacgaa gtgatgtcct aagtcgccat gctaggggac acaaccaacc agctgccaat       180
     gcggcggtta gaccaggtgc tggtcttcct gccacaccga ccaatcaggc cccagctgat       240
     cggtcgtcaa caatgacagc ggatactcag aactacgtcc ttggtatcgg tgcggagagt       300
     gctcgcccgc tccagcatgg ttcgtcggca cctcataatt cggcattttc tgcggctctc       360
     gatcagcagt cgacttcctt ggacttcctt gccaatgtct cggctcatca gcctcgcacc       420
     gaaccaatag ccaatcaagt catggcaagt gagcatcaag agtatcttgg ctggaatgat       480
     gtgcctgttc cggaccaaca atgctacaga ggcactatgc ttgatccatt gcataacgac       540
     atactgcaat tctggctgga accgcaggga gactcgatct cacagcaagg atcaatagat       600
     cttgggggaa attctaatct cggcatgtta ggaggagctg ttgcttcctc agaatcaaga       660
     ccatctattg gtagcatgag cttgagctct ggaggcagta ttccaattga acggtttgcc       720
     cgtgttcagc gctattggct tgctccatcc aacaacactg ggcggctcat gaacagctta       780
     tggcacgata tagcctacag cgaagaggac aatgtctttg ctcttaggcc aacccactct       840
     tccagcggcc cgtcaggtta catgcagggg tcgaggtatg gcgtcgatga agaatgcagg       900
     cagcgtcttt atacaatctt cagtcagagc cgaggtcaat ttcagatgcg ttcgtctgag       960
     agtaccgcag tgtcaccttt tacccaacca ccgcgcaaca actccaattt tcctcctgcg      1020
     gaaatcctag atatggcact agatctattc ttccgcgact tccacccact ggtgccgttt      1080
     atccatgtcc caacattttc tgcgaaagat gcgcgtccat ccttgctcta tgccatgtgt      1140
     ctgattggca tggtcctgtt gggaaccaaa ggcacgttaa actttgtcgt caacaacttc      1200
     tcgtcgatgc tcgagagtgt tacagcagat ttgtccaagt gttctgtggg ggttgagggt      1260
     tctttgtcca cagtgtctac attcgcagct gcttttctgt ttctgaacct ggctgccatg      1320
     acaggggaaa aggagcacct cgtaaagtgc cagatgctct atgtcaatct catatcgatt      1380
     gcgcagcgac atggactatt tgcagctagg gaagggcagg tgcttggcgc gaacttattc      1440
     gatgcaattc ctaatactga aacgcggtgg aaagcctgga gcaaggtcga atcagtgaaa      1500
     cggcttataa ctggactatt gctacttgac tcttggtact catcattcat gtctacaagt      1560
     ccgatcatcg tgcctgactc tgtccaaatg atactcccgt gtgaggaagc gctctttcga      1620
     gctacttcct ccactcgctg gatgcagcta agcgacagcg acaaagtcag gttgatgcct      1680
     acaatactga tgccatcgga gaatgtcgac gttccaacac ttcacagccc ggtagatgat      1740
     ttctgcatgt atgcagtgct agcaatggtt cagtcgaggc tttcagaagc ctattatcga      1800
     cttctttcga atcgtgccag ctaccccttc gccccgtgca acacatacgc catggacggg      1860
     cgtgcaagat gtctaccatc tcttcagctc cagctgacaa gcaaatatgg cgacgtgctc      1920
     gaccgactga accccaacgc agccgtcatg tggcacaaca tgtgcatgac gctaacagca      1980
     gacactcaga tcttcgacat ggcagctggt cgttcaggcc caggccctgc tcggaaagca      2040
     ctcgatgaca ttgcagcatg gtcgcaaacc ccggctgcca gacgggcttg cttgcatgcg      2100
     gcacacatct accgagccat gacgaaccgc agggcatcgg accatacaat gtttcactct      2160
     gtgttttctc ttttctacgc agcactggtg ctgggtcttt acgtcttcat ggtgccaaat      2220
     ccctctgaaa tgcagcgggg cgggaactcc atcgagcttt tcgacgatat tgattggcag      2280
     aaagtgggaa cagagggatt cactagcttc atggagcctc gaaaaggtca acctttccca      2340
     ccgtctgaag aaccagcgtt ggaattcatt aagaatggcg gcacggtata cctacgcggt      2400
     gttcccatcc aaggaggcta tcaagcagcc cgccgcatcc tgctcgacta cgcgggactg      2460
     ctaaaggata cggggaagtg gagcgtacgg aagttttcgt atgtgctgca tatcatgagc      2520
     gatgtgctga tggatgtgga atga                                             2544
//

If you have problems or comments...

PBIL Back to PBIL home page