(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE28

ASPNC_1.PE28         Location/Qualifiers
FT   CDS_pept        join(71813..71815,71851..71936,72030..72094,72190..72239,
FT                   72480..72503,72727..73004,73067..73574)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874693"
FT                   /orf_name="An01g00310"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An02g10090 - Aspergillus niger"
FT                   /protein_id="CAK43422.1"
FT                   /db_xref="UniParc:UPI0000EF9EF8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7D8"
FT                   /transl_table=1
FT                   /translation="MGNCIDMPSYPWISRGTKQRRNRANQETPSEVEGQNRTWHSLGGL
FT                   RGAVPGAGLVAKSTAVFTDLETAVQLSATTKEVESSSEDLSSVPFVPQPRSFLQAHPTI
FT                   SRLPFPNYIPLADRDEARENGWLVTDEENCSQEAAFFFTQWATANRVFHRPYSSLMDFC
FT                   GVHKMTPPSPFMSFATQIGWCPPTGRCWGIRLFLEPQSRNSAPLPHVAAVAYQPMNARD
FT                   GSILGGELVAILSIMHSRVKEPKVESEEVMEGLSDMNEQELEDLSKKSPAFPDEQKFPV
FT                   LLVSFVGPQHARLLCASLNTNLLVIHLSKLYSFEREQDAPLDLFMSWLFARPVAGA"
     atgggaaatt gcattgatat gccaagctac ccttggataa gtcggggcac caagcaaaga        60
     aggaacaggg ccaatcaaga gacaccaagt gaggtagagg gccagaacag aacatggcac       120
     tctcttggtg gtttgcgcgg cgccgtgccg ggagcaggat tagtagcgaa aagcactgct       180
     gtattcaccg atctggaaac agccgtacag ctatccgcaa ctaccaagga ggttgagtca       240
     agctctgaag atctgtcatc ggtaccgttc gtcccgcagc ctcggtcgtt tttacaagcc       300
     caccccacaa tttctcgtct tcccttcccc aactacatcc cactggccga tagagacgag       360
     gctcgggaaa atggatggtt ggtgaccgac gaagagaact gttcccaaga agctgctttc       420
     ttcttcaccc aatgggctac tgccaaccga gtcttccatc gtccgtactc atcactgatg       480
     gatttctgcg gagtacacaa aatgacgcca ccgagtcctt tcatgagttt cgccacacaa       540
     atcggatggt gtccacctac aggacgctgc tggggcatcc gccttttcct tgagccacag       600
     agtcgcaata gtgcaccact tccccatgtt gccgcggtgg cttaccagcc aatgaatgcc       660
     agagatggct caatattggg tggtgagctc gttgccattc tttcaattat gcatagccgt       720
     gtcaaggagc ccaaagtgga gagtgaggag gtgatggaag gtctatctga tatgaatgag       780
     caagagcttg aagatctttc caagaaaagc ccagccttcc cagatgaaca gaagtttcca       840
     gtcctactcg tgtcctttgt gggcccacag catgcacgac tactttgtgc ctcattgaac       900
     acaaaccttc tggtcattca tctctcgaag ctttatagct tcgagagaga gcaggacgct       960
     ccactcgatt tatttatgtc ctggctgttt gcgcgtcctg tggcgggagc ttga            1014
//

If you have problems or comments...

PBIL Back to PBIL home page