(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE282

ASPNC_1.PE282        Location/Qualifiers
FT   CDS_pept        join(708426..708791,708856..708945)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959934"
FT                   /orf_name="An01g02990"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43665.1"
FT                   /db_xref="UniParc:UPI0000EF9F52"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q842"
FT                   /transl_table=1
FT                   /translation="MPYYVHLQEHVVDGMLEPIMRKYYLMTAANATAAEKFLVGLQKYA
FT                   RTPNTQMYNAKAVTLEWWNCKVSSAGTIRWIYNEMIAERPENYNYVQELTDCCDTILIS
FT                   DLEAVNWPILPVNQETSQNGLGGYGHVVVGFPILLAVACIENDQNAK"
     atgccgtact acgttcacct tcaagagcac gtagtcgacg ggatgctgga acccatcatg        60
     cgaaagtact acctgatgac tgctgcaaat gccactgcgg ccgagaaatt tcttgtcgga       120
     ctgcagaaat atgcccggac accgaacacg cagatgtata atgctaaggc ggtgaccttg       180
     gagtggtgga actgtaaagt cagttcagcc ggtaccatcc ggtggatcta caacgaaatg       240
     attgccgaaa ggcctgagaa ttacaactat gtgcaagaat tgaccgactg ctgtgataca       300
     atccttatct ccgatttgga agcagtgaat tggccaattc ttccagtcaa tcaggaaact       360
     tcacaaaatg gtttaggggg atatggtcac gtggttgtcg gtttcccgat tctcttagcg       420
     gtagcatgta tcgagaatga ccagaatgcg aaataa                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page