(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE285

ASPNC_1.PE285        Location/Qualifiers
FT   CDS_pept        join(complement(714315..714344),complement(714201..714281),
FT                   complement(713899..713933),complement(713828..713841),
FT                   complement(713705..713742),complement(712979..713674))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876808"
FT                   /orf_name="An01g03020"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43668.1"
FT                   /db_xref="UniParc:UPI0000EF9F55"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q845"
FT                   /transl_table=1
FT                   /translation="MDATTTNAYNSRVIVDPSRTGTGTAHRGSHASAKRSAWLVIPAGF
FT                   GNRSAVGITQSAVRLARTVETCINLIPLSGPAKGYIEALEHRLHETESLLLNLLAQIPD
FT                   SQLSASVQGRQDRSSRHRNSGSPPQTYSSSSSRLGKRGTDYWKRFPLHTVQDIRDWQND
FT                   CLSNDGDGSTRHSSGPEAVKRPSASQSEYQPETVSPKDQMPEFQGYRDMPTLPRIHQIE
FT                   IPNSPIDAGSSPAKVAYGSGFDGEARENRPRMDPVFEAIQYQRARAEAVHEFPGMQKPS
FT                   LWRGAPSVSFQQQFLW"
     atggatgcca caaccaccaa cgcgtataat agcagggtga ttgttgatcc ctcaaggaca        60
     ggcacaggca ctgctcacag aggaagccac gcgtcggcta agcgttcagc ctggcttgta       120
     attcctgccg gtttcggaaa cagaagtgca gtgggaataa cacaatcggc cgtgcgactg       180
     gcccgaacag ttgaaacgtg tatcaacctt atacctctta gtggcccggc aaaaggttat       240
     atagaagcct tggagcatcg tctccatgaa acagaaagtc tgcttctgaa tctactcgcc       300
     caaatcccag attctcagct ctctgcttcg gttcagggac gccaagatcg ttcaagcagg       360
     cataggaata gcggcagtcc gccacaaacg tactcatcat catcttcccg cctcggaaag       420
     cgaggcaccg actattggaa gagatttcct ctacacactg tccaggacat ccgtgactgg       480
     cagaatgatt gtttgagcaa tgatggagat ggttcgacac gacactcttc gggacctgaa       540
     gccgttaagc gtccttctgc ctcacagtct gaataccaac cggagactgt atctccaaaa       600
     gaccagatgc ctgagtttca aggctatcgc gacatgccta cgctaccacg gatacatcag       660
     atcgagatac caaacagccc gatagatgcc ggttcatcgc cggccaaagt tgcatatggc       720
     agtggattcg atggtgaggc cagagagaat cgtccacgga tggatcctgt tttcgaagca       780
     atacagtatc agcgcgctcg agcagaagcg gtccatgagt tccctggtat gcagaaaccg       840
     agtttgtggc gaggtgcacc ttctgtgagc tttcaacaac aatttctttg gtag             894
//

If you have problems or comments...

PBIL Back to PBIL home page