(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE289

ASPNC_1.PE289        Location/Qualifiers
FT   CDS_pept        join(complement(724276..727293),complement(723548..724219))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211433" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876811"
FT                   /orf_name="An01g03060"
FT                   /product="Function: pub1"
FT                   /EC_number="6.3.2.19"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAK43672.1"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG329855"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="UniParc:UPI0000EF9F59"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q849"
FT                   /transl_table=1
FT                   /translation="MFQSFTGNSRRPRQVNLGGRNTNPFAAYPSGRQNPHGAGPQNTLA
FT                   IAQQERLARQQERERLTASRLVQRTWRGYRSRKITRRTWRNEWDTTEKKQGKDHVPSFE
FT                   ILAQQPDVVLQPSLRYGTAADCLSQLRLLVQFLEPWDSGDIARLVYFSEAFQRTLHEVP
FT                   SIATEGEWTTPLKKLASLTLRVLRSVTSPTVPVFAVQRLLQLLVFLTGLIPKHMARLAK
FT                   EYYSVMVILTTDFESISTRYKLSRDSLTESVLALLRPITSETLTAYEWFAKIYLTIPNL
FT                   PEYIGSLDGLANNINYKLLTSALGPLQTLFGDRPKSAEDVDARLWLLAYFIFFHRCALG
FT                   GQTGRPAPEPGFVKVVSELLNSTAVHISRRLESEESNDYDEAPEQTPLHPFIKEQLVSL
FT                   VNQSNITGLLSQLHTTHLSQGELANAQSDASKEAKILATYALTLLRVFPRRGDDIRMWL
FT                   YLGSATSSDQLTGQEGSRIPAIKYFWQASKASRIFAAISQDSTKVLPLLKPAEESQGTR
FT                   SPEISQVERDEEWTIILLFLELYTFVLKVMDDEEFFSSESSFTASSNTRVSWTKESALP
FT                   LKDIKDMTIFLKNLGFTLYWNSADLSEKEATQDTGGIRSYFSSSAAPPDAIASVRDIEM
FT                   KNKEKGLPGVTGIPLDYFKGLVTGLLRMIHERDSRRKFLPDGHWLMTSRFDMEGFIPAV
FT                   VAEEENRHQLQDEDEEEEQDDLMSDAYFEPSPGLIGTGRAQLTRRIEALRRRQQQAARR
FT                   KQLEAVAPRMEILRNMPFFIPFPTRVQIFREFIYRDQMRRRQGYIDPDAWRMSVAQASM
FT                   GRLIDGRPAVQDILSRHHANIRRESIFKDAFDEFYELGDGLKEPIQITFIDKFNTTEAG
FT                   IDGGGVTKEFLTSVTSEAFKSTSDLNLFEENDQHLLYPNPAAVEQRRELLRQLGFVENT
FT                   AEWNENVRDLLRRYEFLGRIIGKCLYEGILVDVNFAPFFLLKWALTGGTGSAQRETAYR
FT                   ANLNDLKDLDQGLYQGLLQLKNYPGDVEDFSLNFTVTDTIPLPDGGNRTTTRDLKSHGS
FT                   DIPVTNQNRLVYISYIARYRLQVQPALQTNAFLQGLGQIIQPSWLSMFNQTELQTLVSG
FT                   DSGDIDVADLRRNTLYGGVYTIGDDKEEHPTVKLFWEVMEKMSNEERQKVLRFVTSTPR
FT                   APLLGFSHLNPRFSIRDSSEDQERLPSTSTCVNLLKLPRYTNANILREKLLYAVNSGAG
FT                   FDLS"
     atgttccagt catttacggg gaactcccgc cgtccacggc aggttaacct cgggggccgc        60
     aatacgaacc ctttcgccgc atacccctct ggtcgacaaa atcctcacgg cgcaggccct       120
     cagaatactc ttgcgattgc ccaacaggaa cggcttgcga gacagcagga aagagagcgg       180
     ttgacggcga gccgactcgt ccaacggaca tggaggggtt atcggagccg gaagataacg       240
     cgcaggacgt ggcgcaacga gtgggatacc acggagaaga agcagggcaa agatcatgtt       300
     ccctcctttg agatcctcgc ccaacagcct gatgttgttc tgcaaccatc cctccgatac       360
     ggaacagctg cggactgctt atcgcagctt cgtttgctgg tccagttcct ggaaccgtgg       420
     gacagtgggg atattgcccg gctggtatac ttctccgagg catttcagag gacattgcat       480
     gaagtaccct cgattgcgac cgagggggaa tggaccacgc cgctgaagaa actggcgagt       540
     ttgactctcc gtgtcttgcg gtcagtgacg tcgccaacgg taccggtttt cgcggttcaa       600
     cgtctccttc agctactcgt ctttctcacg gggctgatac cgaagcacat ggcacgactg       660
     gccaaagaat actactcggt tatggtgatt ctcacaacag actttgaatc aatatctacg       720
     aggtataagc tgtccaggga tagccttact gagagtgtgc ttgctttgct tcgacctatc       780
     acatctgaga ctcttacggc ctacgagtgg tttgcgaaaa tctatctaac catccccaac       840
     ctcccggagt atattggaag tctggatgga ttggcaaaca atatcaatta taaattgctg       900
     acctccgcct tggggccgtt gcaaacgttg ttcggagacc gacctaagag cgcagaagat       960
     gtagatgccc gtctttggct gcttgcttat tttatattct ttcaccgttg cgctctggga      1020
     ggccagacag gtcgtccggc tccagaacca ggttttgtga aggtggtatc ggagctgctg      1080
     aactctaccg ccgtgcatat atctcggcgc ttagagtcgg aagagtctaa tgactacgac      1140
     gaggcgcctg aacaaacgcc actgcacccg ttcatcaagg agcagctagt tagccttgtg      1200
     aatcagagta atattacggg gcttctttct cagctacaca ctacacatct ctctcagggt      1260
     gagctggcaa acgctcaatc ggatgcatct aaagaagcca agattcttgc aacatacgct      1320
     ctgacgctgc tgagagtatt ccctcgccgg ggtgatgaca ttcggatgtg gttgtatttg      1380
     ggatcggcga cttcgagtga ccagctgaca ggccaggaag gctcaagaat acccgcgatc      1440
     aaatactttt ggcaagcatc aaaggctagc agaatatttg ctgccattag tcaagattcg      1500
     acgaaagtgt tgcctctgct gaaaccggcc gaggaatcgc agggtactcg gtccccggag      1560
     atatcccaag tcgaaaggga tgaagaatgg acgatcatac ttctattcct cgagctctat      1620
     actttcgttt tgaaagttat ggatgacgag gagttctttt ccagcgagtc ttctttcacc      1680
     gcctcctcga acacaagagt ttcctggacc aaggagagcg cccttccact gaaagacatc      1740
     aaagatatga caatatttct caagaaccta ggtttcacat tgtattggaa ctcagcagat      1800
     ctgagcgaaa aagaagcgac tcaagacact gggggcattc gaagctactt tagctcatct      1860
     gcagcgccac cggacgctat tgcaagcgtg agggacattg aaatgaagaa caaagagaaa      1920
     ggcctccccg gcgtcacggg aattccgctg gactacttca agggtctagt cactggcctc      1980
     ttgcggatga tccatgagcg tgattcaagg cggaaattcc ttccagacgg gcattggttg      2040
     atgacaagcc gcttcgacat ggaaggcttc atccctgccg ttgtagcaga agaggagaat      2100
     aggcaccagc tgcaagatga ggatgaagag gaggaacagg atgatctaat gagcgatgcc      2160
     tacttcgagc cttccccagg cctgatcggt accggccgcg ctcaactgac acgtcgcatc      2220
     gaggcactga gacgtcgcca acaacaggct gctcgccgga agcagctgga ggctgtggcc      2280
     ccgaggatgg agattctccg caacatgcct ttcttcatac ctttcccgac gagagtccag      2340
     atcttccgcg aattcatcta tcgggatcaa atgcgtcgaa gacaggggta tatcgaccca      2400
     gatgcctggc gcatgtctgt ggcgcaagcc tcaatgggcc gtctgatcga tgggcgtcct      2460
     gctgtgcaag atatactgag ccggcaccat gccaatatca ggcgcgagag catcttcaaa      2520
     gacgcattcg atgagttcta cgagttgggg gatgggttga aggagcccat tcagatcacg      2580
     ttcattgaca agtttaatac aaccgaagct ggtatagatg gtggtggtgt gaccaaagag      2640
     ttcctcacga gcgtgactag tgaagccttt aaatcgacaa gtgatctaaa tctatttgaa      2700
     gagaacgatc agcacctgct ctatccgaac ccggctgcgg ttgagcagcg acgagagctt      2760
     ctgagacagc tcggctttgt cgagaacact gcagaatgga acgagaacgt ccgtgatcta      2820
     cttaggcgct atgaattcct aggccgtatc attggaaagt gtctatatga gggcatcttg      2880
     gtggatgtca actttgcccc gttcttcctg ctgaagtggg ctttgacggg cggcacgggt      2940
     tcggcccagc gcgagacagc ctaccgcgcc aacctgaacg atctgaagga tctggaccag      3000
     gggctatacc aaggattgtt gcaactgaag aactatccgg gcgatgtgga ggacttctcg      3060
     ttgaacttca ccgtcaccga cacgataccg cttcccgacg ggggtaaccg tacgactacc      3120
     cgagacttga aaagccatgg gtcagacata cctgttacga atcagaaccg gttggtttat      3180
     atctcttaca ttgctcgcta ccggcttcaa gtccagcctg ctctgcagac caacgctttc      3240
     ctccagggcc tgggacaaat catccagccg tcgtggctgt cgatgttcaa ccagacggag      3300
     ctgcagacgc ttgtgagtgg cgattcagga gacattgatg tagccgactt gcgacgcaac      3360
     acgctttacg gaggagtata cacgatcggg gacgacaaag aagagcatcc caccgtcaag      3420
     ctgttctggg aagtgatgga gaagatgtcc aacgaagaaa gacagaaagt gcttcgattt      3480
     gtgacatcga ccccgcgggc tcctttattg ggtttcagcc atctcaatcc tcgattcagc      3540
     attcgagact cgagcgagga tcaagaacga ctccccagta caagcacctg cgtgaatctt      3600
     ctcaagctgc cccggtatac caacgccaat atcctccggg agaagctttt gtatgcggtc      3660
     aattccggag ctggatttga tctgagctga                                       3690
//

If you have problems or comments...

PBIL Back to PBIL home page