(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE29

ASPNC_1.PE29         Location/Qualifiers
FT   CDS_pept        join(complement(74092..74876),complement(73906..73954))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217547" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959386"
FT                   /orf_name="An01g00320"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An08g08380 - Aspergillus niger"
FT                   /protein_id="CAK43423.1"
FT                   /db_xref="UniParc:UPI0000EF9F18"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7D9"
FT                   /transl_table=1
FT                   /translation="MTAIILPEDQNGWRDQARRNKVENQTLRMNVKLYSASHVSHRQYL
FT                   LFRTLLPPIVQPNQLNVQTFGKPHLMIPANQRLNCLAFNEYIANFTNRQAQATGWVWGG
FT                   TDRLFRVPAVQQQQVIRNLTINGINRGATESTVNTAFLSFLHALSDLCPQPAQRLWTTE
FT                   RKKLVADFGTPQRERKFVAYTDGQLEDATTGRILALVECKRSWRDNHSPKVDMQEVAEI
FT                   VAWIKNFPAVAGAADSRVLLSKDGTELYICVFGYDDGWLSHFKRESNHTSEDYCK"
     atgactgcca taatattacc agaggatcag aatggctgga gagaccaagc aaggagaaac        60
     aaggtggaga atcaaactct acggatgaac gtgaagttat attccgcatc gcatgtcagc       120
     caccgccaat acctcttgtt tcgcaccctc ctccctccca ttgtacagcc aaaccagctg       180
     aacgtccaga cgtttggaaa accacatctt atgattccag ccaatcagcg gctaaattgt       240
     ttggcgttca acgaatacat cgcgaatttc accaatagac aggcgcaggc gacggggtgg       300
     gtctggggtg gaacggaccg cctctttagg gtcccagcag tccaacaaca gcaggtcatt       360
     cgcaacctga ctatcaacgg tatcaatcgc ggcgcaactg agtcgaccgt caatactgcc       420
     tttttatcgt tcttgcacgc cctttcagac ttgtgtccgc agcctgctca acgcctatgg       480
     acaacggaga ggaagaaact cgtggcggac ttcggcacac cgcagcgtga gagaaaattc       540
     gtggcctaca cagacggaca gctggaagat gccaccaccg gtcggatttt ggcactcgtc       600
     gaatgcaaaa gatcatggag agacaatcac tctccgaaag tggacatgca agaagtggca       660
     gagatagtcg catggattaa gaattttccc gcggtagcag gggctgctga ttcacgagta       720
     cttttgtcga aagatggtac cgagctctat atttgtgtct ttggttacga tgatggatgg       780
     ttgagtcatt ttaagagaga gtccaaccac accagtgaag attactgcaa ataa             834
//

If you have problems or comments...

PBIL Back to PBIL home page