(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE291

ASPNC_1.PE291        Location/Qualifiers
FT   CDS_pept        join(729584..732322,732411..732593)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211457" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806687"
FT                   /orf_name="An01g03080"
FT                   /product="Similarity to hypothetical coiled-coil protein -
FT                   Schizosaccharomyces pombe"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="small-subunit processome"
FT                   /protein_id="CAK43674.1"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0032040"
FT                   /db_xref="HOGENOM:HBG329858"
FT                   /db_xref="InterPro:IPR006709"
FT                   /db_xref="UniParc:UPI0000EF9F5B"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q851"
FT                   /transl_table=1
FT                   /translation="MPRRQTQMRGPKDRDQSLQKSKKPAPKNKKSGNYLNAFAIAESEN
FT                   PGKLGVKRTRLGKEDEPFKRKRHNARDADDSDGPDYSKRRRTGDDEASEMDSNAGSDGE
FT                   GHRWRIGEVGSDDDSELDSDEAMGSSDEERFEGFTFRGSSTMKNKPKQKAPERKKRTRE
FT                   INLSEDAEVSEDEDDLEDDSDDLGEDAIDLTTAWDMNMAEEEEEKAKKAKSKSKQSAES
FT                   DESEEYDSESEDSDSDDNDDELPLSGDDMDEDEVDEHGLSKLQSFVNAMNTEGTTKTAR
FT                   KTGGKQEQGAPTEFGLTSTRKLTIADLLPSITDSRLKSSLKHVDATTTSNTKTSGVPGK
FT                   LDAPLAKRQQDRLDRAAAYEKSKETLDRWLETVKANRRAEHLVFPLPDPEANQTHRMGA
FT                   AEPRTDLESTIQNILQESGLIENNGKSAEEQVQEFEELQARKLPIEEIRARRAELRKRR
FT                   DLLFREEVRAKRIKKIKSKSYRRVHRKERERLEQQERQALLEAGVDLDEEEREKNDRLR
FT                   AEARMGSKHKESKWAKSLKQTGRTAWDEDARRGTQDLALREEELRKRIEGKRVTNGDED
FT                   YLGSSSSESEDEDPWDEEAGSDAEKRKIRQKLSQLEGDDDADTELKGPHAKLLSMKFMQ
FT                   NADAARKAENDAEVRRLNRELHGEESQSEAESEVGRRKFGRKKEEAKTAKESKAKLARN
FT                   EFEEAPGSDDEAQQEADQEVDIVVDRPAKKGPAAPQNKPRGRPQKEIAEEEDAAAVEEN
FT                   PWLVQTNRNNRRAIVNDSQQTVDITLDDANASSGKSKSAPKAQKASAPSKKKVDAEVYG
FT                   SDDEESVPVLLKNHDLVKRAFAGDEVVQDFEQEKFDTIKEEDDQVIDNTLPGWGSWAGD
FT                   GISKKQQKRQKRFLTKVEGVKPEDRKDAKLSRVIINEKRVKKNTKYMATQLPHPFETKQ
FT                   QYERSLRLPIGPEWSTKETFQNATKPRVMIKQGVIKPMEKPMA"
     atgcctcgca ggcaaacgca aatgcgcggt cccaaagacc gggaccagtc cttgcagaaa        60
     tcgaagaagc ccgcacccaa gaacaagaag tccggaaact acctaaatgc atttgcgatc       120
     gcagagagcg aaaatcctgg aaaactggga gtcaagcgca cccgtctagg caaggaggac       180
     gaacctttca aacgcaagcg acacaatgct cgagatgccg acgactcgga cggcccggat       240
     tacagcaagc gccgtcgcac tggagacgat gaggcgtcgg aaatggactc gaatgctggt       300
     agcgatggcg aaggacaccg gtggaggatt ggtgaggtcg gcagtgacga tgacagcgag       360
     ttggacagtg acgaagccat gggttccagt gatgaggaga ggttcgaggg cttcacgttc       420
     cgcggcagtt ctacgatgaa aaacaaaccg aagcagaagg ccccggaacg caaaaagcgc       480
     actcgcgaaa ttaacttgtc cgaggacgct gaagtatcag aggacgagga cgatctcgaa       540
     gacgactcgg acgacctcgg agaggatgcg atagacctga ctacggcttg ggatatgaac       600
     atggcagagg aagaagagga aaaggctaag aaggccaagt ctaagtctaa gcaatcggct       660
     gagagcgatg aatcggaaga atacgactcc gaaagcgagg acagcgactc ggacgacaat       720
     gacgatgaac tgccattatc gggagacgac atggacgaag atgaggtgga tgagcatggt       780
     ctttccaagc tacagagctt tgtcaacgct atgaacaccg agggtactac gaagacagca       840
     cgaaagaccg gtggaaagca ggaacaaggg gcccctacgg agttcggtct gacttctacg       900
     cgaaaactca ctattgccga tcttttgcca tcaattacag attctcgcct caagagttcc       960
     ctcaagcatg tcgacgctac tacgacctca aacacgaaga cgtccggtgt tcctggaaag      1020
     ctggatgcgc ctcttgcaaa acgccaacag gatcggctgg accgagcggc cgcatatgag      1080
     aagagcaaag agactcttga ccgctggctg gagactgtca aggcgaaccg ccgagccgag      1140
     catcttgtgt tccctttgcc tgatcccgaa gcaaaccaga cgcaccggat gggtgctgct      1200
     gaaccgcgca cggatcttga aagcactatc caaaatattc ttcaggagag cgggcttatt      1260
     gaaaataatg gaaagtcagc ggaagaacag gtgcaagagt ttgaagaact ccaggcgcgg      1320
     aaattgccta ttgaggagat cagggctcgc agggcggaac tacggaagcg tcgtgatctg      1380
     ctcttccggg aggaagtacg cgccaagcgc atcaagaaga ttaagagcaa gtcgtaccgt      1440
     cgtgtgcatc gcaaggagag agagaggctt gagcaacagg aacgacaggc tctcttagaa      1500
     gccggcgtgg acctggatga agaggagagg gagaagaacg atcgcctgag agcagaggcc      1560
     agaatgggtt cgaagcacaa ggagagcaag tgggcgaaga gcctgaagca gactggtcgg      1620
     accgcttggg atgaggacgc tcgacgtggc acgcaggatc tggccttgcg ggaggaagaa      1680
     ctacggaaga ggatcgaagg aaagcgcgtc accaacggcg atgaagacta tcttggctca      1740
     tccagttctg agtccgaaga cgaggaccca tgggatgaag aggctgggtc ggatgctgag      1800
     aagcgcaaga tccgccagaa gcttagccag ctggaaggtg acgatgatgc tgacacagag      1860
     ttgaaggggc cccacgccaa gctcctttcg atgaagttca tgcagaatgc ggatgctgcg      1920
     cgtaaagcag aaaatgatgc tgaagttcgc cgtctcaatc gggagctcca cggtgaagag      1980
     tcgcagtctg aggcggaatc cgaagtcggt cgccggaagt ttggccgcaa gaaggaggag      2040
     gcgaagacag caaaggaatc caaagcgaag ctggctcgga atgaattcga agaagcaccg      2100
     ggttctgatg atgaggctca gcaagaggcg gatcaagagg tcgacattgt tgttgaccgt      2160
     cccgcaaaga agggaccggc agccccccag aataagcctc gtggtcgtcc tcagaaggaa      2220
     atcgcagaag aagaagatgc tgctgctgtg gaggagaacc cgtggctcgt gcagacgaac      2280
     cgcaataacc gtcgcgccat agtgaacgac tcacagcaaa ccgttgacat cacgctagat      2340
     gacgcgaatg ccagcagcgg taaatcgaag agtgcaccca aagcccaaaa ggcatcagca      2400
     cctagcaaaa agaaggttga tgccgaggtg tacggtagcg acgatgagga gagcgtgccg      2460
     gtgcttctca agaaccatga tctggtgaag agggcctttg cgggcgatga agtcgtgcag      2520
     gactttgagc aagagaaatt cgacaccatc aaggaggaag acgatcaagt gatcgacaac      2580
     accctccccg gctggggtag ctgggctggt gatggcatca gcaagaaaca gcaaaagcgc      2640
     cagaaacggt tcctcactaa ggtcgaggga gtgaagccgg aagaccggaa ggatgccaag      2700
     ctctcccggg tcatcatcaa cgagaaacgg gtcaagaaga acaccaagta catggccacg      2760
     cagctccccc accccttcga aacgaagcag cagtacgaga gatcgctccg tctgccaatc      2820
     ggtcctgaat ggtctactaa ggagactttc caaaatgcaa ccaagccacg cgtgatgatc      2880
     aagcaaggtg tcatcaagcc gatggaaaag cccatggctt aa                         2922
//

If you have problems or comments...

PBIL Back to PBIL home page