(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE292

ASPNC_1.PE292        Location/Qualifiers
FT   CDS_pept        join(734393..734554,734608..735136,735192..735301,
FT                   735350..737077,737133..737194,737248..737584)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000211468" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876812"
FT                   /orf_name="An01g03090"
FT                   /product="Catalytic activity: hydrolysis of 1 "
FT                   /EC_number="3.2.1.39"
FT                   /function="endo-1,3(4)-beta-glucanase activity "
FT                   /function="glucan endo-1,3-beta-D-glucosidase activity "
FT                   /biological_process="cell wall macromolecule catabolic
FT                   process"
FT                   /protein_id="CAK43675.1"
FT                   /db_xref="GO:0016998"
FT                   /db_xref="GO:0033903"
FT                   /db_xref="GO:0042973"
FT                   /db_xref="HOGENOM:HBG398584"
FT                   /db_xref="InterPro:IPR005200"
FT                   /db_xref="UniParc:UPI0000EF9D55"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q852"
FT                   /transl_table=1
FT                   /translation="MERKHRWGSSFLLMWLLAAEGVYSAPRRSSSTASPKTQFPPGAET
FT                   ERILPGTNGLYPTSLEREGHPVLPTPTSTGNTKDPWGLDGLLESLGDTADLPNELLSEF
FT                   LPGWGKNYPVTVPVSAYKPASAETTSSATEPQTQPETSDTSTPQAPSQNVPEATTDSSQ
FT                   VSSQASSTTSLTQPSSTTSTTQLSSTTSPTQPTSSASSAQPSSSASLTTTASQTTQADN
FT                   SITSSVVQASVTPMSGQDVFVPLATTPFPQTITARNDHPVPKKGIENVTTPIETNKFYA
FT                   GLFLGSQSNTTFTHPYGLSWAKGSGNAKSYGMAISHNEVNVVANGPTNANIPGNPISYY
FT                   INPIGIQHMILSATELNTSTVLTAENLLPFSADAVLSPTPGSSQRITIPLVQGMGFVTG
FT                   MYNNLQPLIQSGVFFSKVVTASSPRIGIYKYKVSLADGTEWLVYAIPQDGKDPDFRLES
FT                   NTDFRGPSGWSGTVQITKNPAGDSGEKLLDGSSGVFALEAAVSGSVQDNSGTYNLAFAK
FT                   SGKQLQQTPLLMYALPHHVESFDNTTKGRMTSITLRTTTKGNATAVVGETWTMLEPNLP
FT                   TQMGFDPWSVSAGNVNNLSAAAKQVILSVAPTELNQSIDQQSDLNSMYYSGKALSKFAT
FT                   LVYTVNKLGGNPDLAASALQNLKTAFSRFVDNKQQFPLVYDSVWKGVVSSASYGGDSGA
FT                   DFGNTYYNDHHFHYGYFIHAAAIIGSLDSTWLTDSNKAWVNMLVRDAGNSAANDPYFPF
FT                   SRSFDWYHGHSWAKGLFESFDGKDEESTSEDTMFAYALKMWGKTIGDASMEARGNLMLG
FT                   ILRRSLHNYFLMESDNKNQPANFIANKVTGILFENKVDHTTYFGNNLEYIQGIHMLPLL
FT                   PSSPYVRSQNFVREEWNALFSANATDPALNVTGGWKGVLYANLALIDPASSWNFFAQSN
FT                   FDYSWIDGGASRTWYLAFAAGQYIPPTSQSMMLLTTYAGLGGGPA"
     atggagagga aacacagatg gggctcatcg ttcttgctaa tgtggcttct agctgcagaa        60
     ggagtatact cagccccgag acgctcatct tcaactgcgt ctccaaagac gcaatttcca       120
     ccaggtgctg aaactgaaag aatactccct ggtacaaacg gtctctatcc gactagcctt       180
     gagcgcgagg gtcatccggt gctcccaacc ccgacatcga cggggaacac gaaagatcct       240
     tggggacttg atgggctgct tgaatccttg ggcgataccg cagacctccc aaacgaatta       300
     ttgagcgagt ttctaccagg ctggggcaag aattatccag tgaccgtgcc ggtatcagcg       360
     tataaaccgg ccagcgcgga aacgactagc tcagctacgg aaccacaaac gcagccggag       420
     acttctgata cctccacgcc gcaggctcct agccaaaacg tgccagaggc gacaaccgac       480
     tcttcccagg tcagcagtca agcttcgagt acaacaagcc tcacccagcc ttcgagtaca       540
     acaagcacca cccagctttc gagtacaaca agtcccaccc agcctacgag ctcagcgagt       600
     tcagcccagc cttcgagctc agcaagtctg accacgactg caagccaaac aacgcaagcg       660
     gataattcta tcacttcaag tgttgtccaa gcctcagtta caccaatgtc tggtcaggac       720
     gtatttgtgc cattggcgac aaccccattc ccgcaaacca tcacagcgcg gaacgatcat       780
     ccggtgccta agaaaggaat tgaaaatgtc actacgccaa ttgagacaaa caagttctac       840
     gctggactct tcctcgggtc gcagagcaat actaccttta cccatccgta tggtctctca       900
     tgggcgaagg gaagcgggaa tgccaaaagt tacggaatgg ccatttccca caacgaggtt       960
     aatgtcgttg caaatggccc caccaacgcc aacattcctg gcaatcccat ttcgtactac      1020
     atcaatccca ttggcatcca gcatatgatc ctttcagcca cagaactcaa cacctcaact      1080
     gtgctgactg cagagaacct cttgccattc tccgctgatg ctgttctgag tcctactccc      1140
     gggtcaagcc aaaggataac tattcctctt gtgcagggga tgggtttcgt cacaggcatg      1200
     tacaacaacc tacagcccct gattcaaagt ggtgtatttt tcagcaaagt cgtcactgct      1260
     tcctcgcccc ggattggcat ctacaaatat aaggtctctc tggcggatgg aacagagtgg      1320
     cttgtttatg ccatccctca agatggaaag gatccggatt tccgcttgga atctaacacc      1380
     gacttccgtg gcccaagtgg atggtctggg accgttcaga tcacgaagaa cccagcaggt      1440
     gattctggtg agaagctttt ggacggatct agcggtgtct tcgctctgga ggctgctgta      1500
     tccgggtcgg ttcaggacaa ttctggtaca tacaatctgg cattcgcgaa gtcagggaag      1560
     cagctgcaac agactccact gcttatgtat gctctgccgc atcacgtcga atcgtttgat      1620
     aacaccacca agggccgcat gaccagcatc acgcttcgga caacgacaaa gggtaatgca      1680
     actgctgtag taggagaaac ttggacgatg ctggagccga accttccaac tcaaatgggt      1740
     ttcgacccgt ggtcggtatc ggccggtaac gtgaacaatc tgagcgctgc tgccaaacaa      1800
     gtcatcctat ctgtggcgcc cactgagctc aaccaaagca ttgaccagca gtcagacctg      1860
     aatagcatgt actacagtgg caaggccttg agcaaatttg caactcttgt ttacacagtg      1920
     aacaagctag ggggtaaccc tgacctggca gcttcggctt tgcagaatct gaagaccgcc      1980
     ttttctcgct ttgtcgacaa taagcaacaa tttccgttgg tgtatgacag cgtttggaag      2040
     ggtgtggtgt cctctgccag ctacggaggc gattctggcg ctgactttgg aaacacctac      2100
     tacaatgacc accacttcca ctatgggtat tttatccatg ccgctgccat tattggctcg      2160
     ctcgactcga cctggctcac ggattccaac aaagcctggg tgaatatgct tgtccgtgac      2220
     gccggaaact cggccgcaaa cgacccatac ttcccattct cgcgctcttt cgattggtac      2280
     catgggcatt cgtgggcgaa gggtctgttc gagtcgtttg acggcaagga cgaggaatca      2340
     acctcggaag ataccatgtt cgcgtacgca ctgaagatgt ggggaaagac gattggcgat      2400
     gccagcatgg aagcccgcgg caacctgatg ctgggcatcc tccgacgaag cttgcacaac      2460
     tacttcctca tggagagtga taacaagaat cagcctgcga actttatcgc caacaaggtg      2520
     actggaattc tgtttgagaa caaggtggat cacactacct actttggtaa caacctggaa      2580
     tacatccaag gtatccacat gttgcccctc ttgccttcgt ctccatatgt acggagccaa      2640
     aacttcgttc gagaggagtg gaatgcactc ttctcggcca atgccaccga tccagcattg      2700
     aacgtcactg gcggatggaa gggtgttttg tacgccaact tggcactgat cgaccctgcg      2760
     tcttcgtgga acttcttcgc acagtccaat ttcgattata gctggattga tggaggagcg      2820
     tcacgcacgt ggtatcttgc atttgcagcg ggtcagtata tccctccaac ttctcaatca      2880
     atgatgttgc taaccacgta cgcaggcttg ggcggaggtc ccgcttaa                   2928
//

If you have problems or comments...

PBIL Back to PBIL home page