(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE296

ASPNC_1.PE296        Location/Qualifiers
FT   CDS_pept        join(complement(749665..750443),complement(749507..749513))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211501" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959936"
FT                   /orf_name="An01g03130"
FT                   /product="Remark: Protein is rich in proline "
FT                   /protein_id="CAK43679.1"
FT                   /db_xref="UniParc:UPI0000EF9D59"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q856"
FT                   /transl_table=1
FT                   /translation="MSDQSKQPESSTNNPSQEGENNNNNTTSSPSSPQQENPPTGDQEG
FT                   QEQKPEDTNDTTEDKPKEEEKEEDKQEDEDPQPKQEEQEQEPEPEKEPQPKQEPQEQED
FT                   KAPKQEPQSSDEEPEPEPEQRAPQPSQDRKRRSRPPQKLRQRDDYSDMDNNQQVDRPRR
FT                   QRRQRPQQQQQGQDGGPLGGLPGVGQAGDLVQNTAGNALNGVTGSAGKAVGGILGGGGG
FT                   GEEKEGKDEQLRLRLDLNLDIEVQLKAKIHGDLTLGLLN"
     atgtctgatc agtccaagca gcctgagtct tctaccaaca acccttccca agaaggagag        60
     aacaacaaca acaacactac ctcttcccct tcctcccctc aacaagagaa ccctcctact       120
     ggtgatcagg aaggacaaga acagaagccc gaggacacca acgacaccac agaagacaag       180
     cccaaagaag aagaaaaaga agaagacaaa caagaggacg aagaccctca acccaaacaa       240
     gaagaacaag aacaagaacc agaaccagaa aaagaacctc aacctaaaca agaaccccaa       300
     gagcaagaag acaaagcacc caaacaagaa ccccaatcgt ccgacgaaga acccgaaccc       360
     gaaccagaac aacgcgcccc tcaaccctct caagaccgta aacgccgctc ccgacctccc       420
     cagaaactcc gccaaagaga cgactactcc gacatggaca acaaccagca agtagaccga       480
     ccccgtcgcc agcgccgcca gcgcccccaa cagcaacaac agggtcaaga cggcggtccc       540
     ctgggtggcc tccccggcgt cggccaggcc ggcgatctcg tccagaacac agcaggtaac       600
     gccctgaacg gagtaacggg cagtgccggc aaagctgtgg gcgggatcct cggtggaggc       660
     ggcggcgggg aagagaagga aggcaaggat gagcagttgc ggttgagact cgatctgaat       720
     ctggatattg aggtgcagtt gaaggccaag attcatggtg atcttacgct tgggttgttg       780
     aactga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page