(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE297

ASPNC_1.PE297        Location/Qualifiers
FT   CDS_pept        join(752058..752551,753321..753350,753796..753844,
FT                   753963..753997,754028..754097,754451..754501,7
FT                   54550..754591)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110823"
FT                   /orf_name="An01g03140"
FT                   /product="Remark: unspecific blast hits are due to the low
FT                   complexity sequence of the ORF"
FT                   /protein_id="CAK43680.1"
FT                   /db_xref="UniParc:UPI0000EF9D5A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q857"
FT                   /transl_table=1
FT                   /translation="MATAQAEKPATKTFANDPDDVSDYDSEDDYSDDDTQQKPQQQQQQ
FT                   QQQQRRRRRPQQQNPNDEDDTYYSDEYSDDYDDYDDEDDDYYDDEEEEVQAMERYQPTT
FT                   ISSRDNVPAQPIANGGMQEAEGKTGDDWEDQDGMKLKLELNLDIEVELKAHIHGDLTLS
FT                   LLVSTFGFYLIFSCLAYKKRYLWTLTNSTLSTTSPLFIRYNPVIGRNSQMVSWYCEVVV
FT                   KRFFTSNIFGEGGYSLAIRYTLVACSSSTHIREP"
     atggctaccg ctcaggctga gaaaccagcc accaaaacct ttgctaatga tcccgatgat        60
     gtctccgact acgattccga ggatgactat tccgacgacg acacccaaca aaagcctcaa       120
     cagcaacagc aacaacaaca acaacaacgc cgccgtcgtc gtccccagca gcaaaatccc       180
     aacgatgaag acgacaccta ctattccgat gagtactcgg atgactacga tgactacgac       240
     gatgaagatg atgactacta cgacgacgag gaagaagagg tccaggccat ggaacgctac       300
     cagcccacca ccatcagcag ccgcgacaat gtgcccgcac aaccgatcgc aaacggcggc       360
     atgcaggagg cggaaggcaa aaccggcgat gactgggagg atcaagacgg aatgaagttg       420
     aaattggaat tgaacttgga tatcgaagtc gaattaaagg ctcatatcca tggtgatttg       480
     acgttgtcgt tgctggtatc tacctttgga ttttatctca tattttcatg ccttgcttat       540
     aagaaaagat atctctggac attaactaac agtacgttgt ctactacttc tcctttgttt       600
     ataagataca atcctgttat tggtcgtaat tctcagatgg tttcttggta ttgtgaagtg       660
     gtcgtgaaac gattctttac ctcaaatata tttggagagg gtggatatag tctagctata       720
     cgatatactc tcgtagcctg ttcatctagt actcatatca gagaaccttg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page