(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE307

ASPNC_1.PE307        Location/Qualifiers
FT   CDS_pept        complement(781851..783725)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211578" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806932"
FT                   /orf_name="An01g03240"
FT                   /product="Similarity to hypothetical protein B23I11.30 -
FT                   Neurospora crassa"
FT                   /protein_id="CAK43690.1"
FT                   /db_xref="HOGENOM:HBG329869"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI0000EF9D7A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q867"
FT                   /transl_table=1
FT                   /translation="MLAELPPEIIQLITSYLPSASALVNLSRTCWRLHHVVAAQDWRIF
FT                   RSFVETKFPGVETPEIWREAAQALTSRSRALDKHAVVGRFVVPASEAVKVGSHSSTRRD
FT                   NPTHGYRPALDSYEVWNGSSWNDRKEVLAWGAADELVLRIAEPGPNSKGKWVVFNDLDH
FT                   ISSHDDICGVHILRPGHPSKEPQTEHIVVARARGELFHLSIDPNIACHIYKQRFMTSGG
FT                   GIERTDMSDGKDPILSAHLSDGSISFFSTTSGEAEVYPFARLNADSSNNATISSRHKYS
FT                   KFLSPSLFAVGTGRIHDAITISAITPQGLSPSRELNVELVDFERLNLDTTIRSNVNAIA
FT                   PLDPTGQVFLAAWGDRAIRYNHPICHYSTLYANTLRLHDLRSNEEYEKTYRDTTDQNPI
FT                   YCIHPFGHDRFVVGAGGDALVKIFDLRMPKHDTYSYRDARPSRTLLKNNEPIVDSLSSL
FT                   SLTATNNSIAFPRKDISIFLSAHPPSSRPQGRRRHNTRSYRGAIYSMTSPSPSSPTIYT
FT                   GVADGVVRLDFASTDDLLGPCQDWYREPLLLSNDVRLENTVAHTRSADKVLDLSGYERP
FT                   EDTTASITLRTQQPFVFVGVEDGLAEEITGWDRRWERLEKPGAWRRAD"
     atgcttgcag agcttcctcc agagattata cagcttatta caagctattt gccatctgcc        60
     agcgcgcttg tgaatctgtc aaggacctgc tggcgcctac accacgttgt cgctgctcaa       120
     gattggcgaa tcttcagatc cttcgtcgag accaagtttc ctggtgtgga aacgcccgaa       180
     atctggcgag aggccgctca ggcactcaca tctcgctctc gggcattaga caaacacgca       240
     gtcgtcggaa gatttgtcgt acctgcctca gaagcagtca aggtcggatc ccatagttca       300
     acacgacgtg acaatcctac tcatggatat cgccctgctt tggactcgta tgaagtctgg       360
     aatggctctt catggaacga ccggaaggag gtgctcgcct ggggcgcggc agatgaacta       420
     gttctgcgca tcgctgaacc tggccccaat tcaaagggga agtgggtggt cttcaatgat       480
     ctcgatcaca tcagcagcca tgatgacatc tgtggtgtcc atattctacg tcctggacac       540
     ccttccaagg agccccagac tgaacatata gtcgttgcaa gagcgcgcgg agagcttttc       600
     catctctcta tcgaccctaa tatcgcctgc catatttaca agcagcggtt catgacttcc       660
     ggagggggca tagagagaac agatatgagt gacggaaagg acccgatctt atctgcccac       720
     ttgagcgacg gatcgatatc tttcttcagc accacttctg gagaggcgga agtctaccca       780
     tttgctcgtc tcaatgctga ttctagcaac aatgcaacca tcagctctcg ccacaagtat       840
     tccaagttcc tttcgccctc tctattcgca gtcggcacag gacgcatcca cgatgcaatt       900
     actatctccg ccatcacgcc acaaggtcta tcaccaagtc gtgagctcaa tgtggagctg       960
     gtagatttcg aaagacttaa tctcgatacg accatcagat ccaacgtcaa cgccattgct      1020
     ccactcgatc ccaccggaca agtcttcctc gcagcctggg gtgatcgagc tatcaggtac      1080
     aaccacccca tttgccatta ttccacgctc tatgctaaca ctctcagact gcacgacctc      1140
     cgctcaaacg aagaatacga aaagacctac cgtgatacca cggaccagaa ccccatctac      1200
     tgcatccacc ccttcggcca cgaccgcttc gtcgtcggcg ccggcggtga cgccctagtc      1260
     aagatctttg atttacgcat gcccaaacat gacacataca gctatcgtga tgcacgccct      1320
     tcccgaaccc ttctcaaaaa caacgaacca atcgtagaca gcctctcaag cctctccctc      1380
     accgcaacca acaatagcat cgccttcccc cgcaaagaca tctccatctt cctctccgcc      1440
     caccctccct ctagccggcc ccaaggccgt cgccgccaca acacccgctc ctaccgcggt      1500
     gcaatctaca gcatgacttc gccctcccct tcctcaccaa ctatctacac tggcgtcgcg      1560
     gatggcgtcg ttcgccttga cttcgcctct acggatgacc tcctcggccc ttgtcaggat      1620
     tggtaccggg agccacttct gctctctaac gatgtgcgtc tcgagaacac tgttgcacac      1680
     acccgctctg ccgacaaagt cctggattta tcgggctacg agcgccctga ggatactact      1740
     gcttctatca ctttgcgcac gcagcagccg tttgtgtttg tcggggtgga ggatggtctt      1800
     gcggaggaga tcacggggtg ggatcggagg tgggagaggt tggagaaacc gggggcgtgg      1860
     agacgggctg attga                                                       1875
//

If you have problems or comments...

PBIL Back to PBIL home page