(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE310

ASPNC_1.PE310        Location/Qualifiers
FT   CDS_pept        join(787507..787881,787943..789046,789321..789626)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211600" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654268"
FT                   /orf_name="An01g03270"
FT                   /product="Similarity to hypothetical conserved protein
FT                   B24M22.130 - Neurospora crassa"
FT                   /protein_id="CAK43693.1"
FT                   /db_xref="HOGENOM:HBG329871"
FT                   /db_xref="InterPro:IPR018961"
FT                   /db_xref="UniParc:UPI0000EF9D7D"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q870"
FT                   /transl_table=1
FT                   /translation="MSRRHVSAFYTNTVAPVCAPRRQSIPLSRCFSVGSVRRTAASSKP
FT                   GEQHENTKTQDETKEEEQGAMARRLSDMTEQAMLEGGRSAQRNMQQAGFSDELKQQLEE
FT                   RVAAAAFKNEYATAHSIVDMPSSAGQGTRDIAGAPAWTGTENTHDITLRMLDDSKKRIR
FT                   TPYKIPQPNPVDMRISPKPKESAGLRLAKARERRATYSLSQSEGISEDEREAMRREMRE
FT                   RFSPGARPMPATLQGLSALANERIEDAMARGQFNRIRRGKGVNTETDHRANSPFIDTTE
FT                   YFMNKMIQKQEIVPPWIEKQQDLAREVDRFRSRLRAEWRRHAARLIASEGGSLDIQMRR
FT                   AGAYAAAEARLAERAKIEQAFRESDSASSSGGLDSSDGAPQSSDSTVSGPQEDKDPLPY
FT                   VTPLRDPQYMNTERSFLELTIKNLNALTRTYNLQAPPVAQKPYLNLERELAACYAEVAP
FT                   SLAEEIKRRATERARPKNSGPQAANILESLSTSSKRRSRRLDTYCQTIPYLFDHGISVN
FT                   NPIYLTSSTAAPNHSVPVPQAPHRVQSANPDDCQQHITRCPQNSQEKRDSSIRPQTHQV
FT                   MSKIKSQYPGSKAVYERD"
     atgagcagaa ggcatgtgag cgctttttac actaatacgg tcgcgccagt atgtgcgccg        60
     agacggcaga gtataccctt atcgagatgc ttctccgttg ggagcgtgcg gcgaactgcg       120
     gcgagttcga agccgggcga gcagcatgag aataccaaga cacaagatga gacgaaggag       180
     gaggaacagg gggctatggc gcggcgactt tcggatatga cagagcaagc catgctggaa       240
     ggaggccggt ccgcgcagag aaacatgcaa caggcggggt tctcggacga gttgaagcag       300
     cagctagagg agagggtggc ggcggcggct tttaagaacg agtatgcgac cgcgcactca       360
     attgttgata tgccgtcaag cgcaggtcaa ggaacacgag acatcgcagg cgctccggca       420
     tggaccggaa cagaaaacac ccacgacatc acgctacgca tgttagacga ctccaagaag       480
     cgcatacgca caccatacaa gatcccccaa ccaaatccgg tcgacatgcg aataagcccg       540
     aagcccaaag agtccgccgg attgcgtcta gcgaaagccc gagagcgcag ggcaacatac       600
     tccttgagcc agagcgaggg tatatcagag gacgaacgtg aagctatgcg tcgagagatg       660
     cgggaacggt tctcccccgg ggcacgaccg atgccggcca cgctgcaggg gttgtcagcg       720
     cttgcgaacg agcggatcga ggatgcgatg gcgcgcggtc agtttaacag gataaggagg       780
     ggtaagggtg tgaatacgga gacggatcac cgagccaata gtccgttcat cgataccacc       840
     gagtacttca tgaacaaaat gatccagaag caggagatcg tgccgccatg gatcgagaaa       900
     caacaggacc tagctaggga ggttgatcgg ttccgatcac gtctgagggc agagtggcgg       960
     cgacatgcgg cccggctgat tgccagcgag ggagggtctc tggatataca gatgagacgg      1020
     gctggtgcgt atgccgcggc ggaggctcga ctggctgaaa gggccaagat agagcaagcg      1080
     ttccgcgaga gcgatagtgc gagtagttct ggagggctgg actcttcaga cggagctccg      1140
     cagagctcgg atagtacagt ttcagggccg caagaggata aagatccttt accctatgtt      1200
     acgcccctgc gtgatccgca atatatgaac acagagcgct cgtttcttga gctgacgatc      1260
     aagaacctca atgctcttac tcggacttac aatcttcagg ctcctccggt ggcacagaag      1320
     ccgtatctca atcttgagcg tgagctggct gcatgttatg cggaagtggc tccaagcttg      1380
     gcggaggaaa ttaagcggcg tgcaactgaa cgagctcgtc caaagaattc ggggcctcaa      1440
     gctgcgaaca tcctggagtc tctgagcaca tcgagtaagc gtcgaagtcg tcgtctcgac      1500
     acatactgcc aaactattcc ttatttgttt gatcacggca tcagcgtcaa caaccctatc      1560
     tatctcacgt cttcaacggc ggcgcctaac cattctgtac ctgtacccca agcgccacac      1620
     cgcgtacaat ccgcgaatcc agacgactgc caacagcaca ttactcgctg tccccagaat      1680
     tctcaggaaa aacgcgattc gagcattcga ccacaaaccc atcaagtgat gtctaagata      1740
     aagtcccagt acccaggaag caaagccgta tatgagcgcg actga                      1785
//

If you have problems or comments...

PBIL Back to PBIL home page