(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE314

ASPNC_1.PE314        Location/Qualifiers
FT   CDS_pept        join(complement(797833..798091),complement(796670..797529))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211633" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877845"
FT                   /orf_name="An01g03310"
FT                   /product="Putative frameshift"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAK32620.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG326214"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EF9D7F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q874"
FT                   /transl_table=1
FT                   /translation="MPLTILSQTQLRSLLLSLSRDQIIELQQNLSNALRDYSTGSQEKG
FT                   CAAAYQPTRTAITRQNGCTTLFMPASTGNTLGMKMISLQDNMTLIDETSLPFGLINAHE
FT                   LTPFRTALTATMTLNKRKRVRTVVVFGAGKQAYWHIRLALILRGEGIKRVYIINRSFDR
FT                   AAQLLRDIYSPENASWRGDVKFSAVSTDFVEYDRILHDALLKADAIFCCTPSTEPLFPA
FT                   QILTSRDGRRKGRLISAIGSYRPHMTELPPELLRDEVTVHSSHRHFHKHVRRSGVVVVD
FT                   SLDAALKEAGEIVQAGIRPHQVVELGELLIVRDASRGEGDNSEDGKSLRDWVERGNVIF
FT                   KSVGMGLMDLVTGGDLVRLAREKGVGTTLEEF"
     atgccactca ccatcctctc tcaaacacaa ctccgctccc tcctcctgtc gctctctcgc        60
     gaccagatca ttgagctcca gcagaacctc tccaatgctc tgcgggacta ctccactggt       120
     agccaagaaa agggctgtgc ggctgcctac caacccacgc gcacggccat cacccgtcag       180
     aatggctgca ccaccttgtt catgcccgct agcacgggca acaccctggg catgaagatg       240
     atctccttac aagataacat gacattgatt gacgagacga gcctaccctt tggattgatc       300
     aacgctcatg aacttacccc ctttcgcacc gccttgaccg ccaccatgac cctcaacaaa       360
     cgcaagcgcg tacgaaccgt ggtggtgttc ggggcgggca agcaggcata ctggcacatt       420
     cggctggcgc tgatcctgcg cggagagggc atcaaacggg tgtatattat caaccgatcc       480
     tttgaccgcg cggcccagct gctgcgggat atctacagcc ccgagaacgc cagctggcgc       540
     ggcgatgtga aattctccgc cgtcagcacg gactttgtcg agtacgaccg catcctgcac       600
     gatgcgctgc tcaaggcaga tgcgatcttc tgctgcacgc cctcgacgga accgctcttc       660
     cctgcacaga tcctcacatc gcgcgacgga cgccgaaagg gccgtctgat cagcgcgatt       720
     ggatcatatc ggccacacat gaccgagctg ccacctgagt tgctgcgcga cgaggtgacg       780
     gtgcacagct cgcatcggca tttccacaag catgtgcgac ggagtggcgt agtggtggtg       840
     gacagtttgg atgcggcgct gaaggaagcc ggcgagattg tgcaggcggg catccggccg       900
     catcaggtgg tggaattggg cgagctgctg attgtgcggg atgcgtcgcg cggggagggc       960
     gacaacagcg aagatggcaa gagtcttcgg gattgggtgg agcgcgggaa tgtgatcttc      1020
     aagagcgtgg ggatgggctt gatggatctg gtgacgggcg gcgatctggt gcggttggcg      1080
     cgggagaagg gagtgggcac gacgctggag gaattctga                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page