(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE315

ASPNC_1.PE315        Location/Qualifiers
FT   CDS_pept        join(798778..798807,798857..798977,799067..799275,
FT                   799311..799409)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111054"
FT                   /orf_name="An01g03320"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36872.1"
FT                   /db_xref="UniParc:UPI0000EF9D80"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q875"
FT                   /transl_table=1
FT                   /translation="MEDYDLRGMGVPVVDGVKHLPTGRYIHRDSRTAVSAYLILSDYAS
FT                   FIPIPQSTFLAVNHPSPLATLTPSSSATATIGPSLCHLIARTDTCSSVQMIKPNTLVNT
FT                   HKIKWKIKITIMIIIIGANLPCLYIQMQDNIKSLINVIIKKDWAVWDA"
     atggaggact atgatctccg tggcatggga gtacccgtgg tggatggagt gaaacatctc        60
     ccaacaggca gatacataca cagagatagt aggactgcag tgtctgccta tctaatacta       120
     tccgattacg catcattcat tccaattcca caaagtacat tcctcgctgt caatcatcca       180
     tcccctctcg ccacccttac tccctcctcc tccgccacgg ctactatcgg cccttcactc       240
     tgccatctca ttgctcgcac ggatacatgt tcctctgtcc agatgatcaa gcccaatacc       300
     ttggtcaata ctcataaaat aaaatggaaa ataaaaataa caatcatgat cataatcata       360
     ggcgctaatc taccgtgctt gtacatacag atgcaggata atataaagtc actgatcaat       420
     gtcatcatca aaaaggattg ggcagtctgg gatgcgtag                              459
//

If you have problems or comments...

PBIL Back to PBIL home page