(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE316

ASPNC_1.PE316        Location/Qualifiers
FT   CDS_pept        complement(799765..801063)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000211223" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111055"
FT                   /orf_name="An01g03330"
FT                   /product="Complex: interaction of A. nidulans pclA with a
FT                   PSTAIRE kinase was shown in vivo"
FT                   /function="kinase activity"
FT                   /function="protein kinase binding"
FT                   /biological_process="regulation of cell division "
FT                   /biological_process="regulation of cyclin-dependent protein
FT                   kinase activity"
FT                   /protein_id="CAK36873.1"
FT                   /db_xref="GO:0000079"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0019901"
FT                   /db_xref="GO:0051302"
FT                   /db_xref="HOGENOM:HBG329874"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR012104"
FT                   /db_xref="UniParc:UPI0000EF9D81"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q876"
FT                   /transl_table=1
FT                   /translation="MAVHPYSPCTNFASPTTNTTSIMDFDRAALHEFIMQPVSRDMISH
FT                   LAQQAMQVIRCEPHVTAHHAHGQPTPPSTPPLDADLPPLPSVTTFITSLVLRSQVQVPT
FT                   LMTSLVYLARLRARLPPVAKGMRCTVHRIFLASLILAAKNLNDSSPKNKHWARYTSVRG
FT                   YEGFGFSLPEVNLMERQLLFLLDWDIRVDEADLLHHLEPFLMPIRRRLQIQEQRQREAQ
FT                   LRQPREWRRFHASADLFAARLHRQKAEGRRMPGESPTRRRLPPSPASSASLSSVSSGSS
FT                   YCASPASVAESERYRPYPPRRRPSTRSHASISSPPAVQEVPGLSRAETLPSLSSRASSI
FT                   APSSRSDTPASLRTSSSITSMNEVHVVDGTRSPSVSNGYVSLAGTKVEELSQPNKKARH
FT                   SLSHAHGPGQTHPGFVARFLASAAGSYMGGRRH"
     atggctgtcc atccctactc tccttgcacc aactttgcat cccccaccac caacaccacc        60
     agcatcatgg atttcgatcg ggcggcgctg catgagttca tcatgcagcc cgtctcgcga       120
     gacatgatct ctcatctggc tcaacaagcg atgcaggtca tccgctgcga accgcatgtg       180
     acagcgcatc acgcgcatgg ccagcccacg ccccccagca cgccgccctt ggatgcagac       240
     ctgcctccct taccatccgt caccaccttt attacctcgc tagttctccg ctcgcaggtg       300
     caggtgccga cgttgatgac ctcgctggtc tatctggccc ggctgcgggc tcgcctgccc       360
     cccgtcgcca agggcatgcg ctgcacagtg catcgcatct tcctggcttc cctgattctg       420
     gcagccaaga acctcaatga ctccagtcca aagaacaagc attgggcccg gtacacctcc       480
     gtccgcggct acgagggctt tggattctcg ctgcccgaag tcaacctgat ggagcgtcag       540
     ctgctcttcc tgctagactg ggacatccgt gtcgacgagg cagacctcct gcatcacctg       600
     gagcccttcc tcatgcccat ccgtcggcgt ctccagatcc aggagcagcg acaacgtgag       660
     gcccagctgc gtcagccccg tgaatggcgt cgctttcacg cctctgccga ccttttcgct       720
     gctcgccttc accgtcagaa ggccgagggt cgccgcatgc ccggcgagtc tcccacgcgg       780
     agacgcctgc cccccagccc agcatcgtcg gcttcccttt cttctgtctc ctcaggcagc       840
     tcctactgcg cctcaccagc ctccgtggcc gaatcggagc ggtaccgtcc gtatccaccc       900
     cgccgacgac cttcgacccg cagccatgcg tccatctctt ctccgccagc tgtgcaggag       960
     gtcccaggcc tatcacgtgc tgaaacgctt ccctcgctga gctcgcgcgc ttccagcatc      1020
     gcacccagct cgcggagcga cacgcccgcc agtctacgta cgtccagttc gatcactagt      1080
     atgaacgagg tgcatgttgt ggatggcacc cgcagcccgt cggtgagcaa cggctatgtc      1140
     tcgctggccg gcacgaaagt ggaggagctg tcgcagccga ataagaaagc ccgacactcc      1200
     ctgagtcacg cacatggacc cggacaaact cacccgggtt ttgtggcgcg tttcctggca      1260
     tccgcggcag ggtcgtacat gggtggccgc cggcattag                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page