(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE32

ASPNC_1.PE32         Location/Qualifiers
FT   CDS_pept        join(84225..84651,85003..85065,85112..85146,85277..85369)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874695"
FT                   /orf_name="An01g00360"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43426.1"
FT                   /db_xref="UniParc:UPI0000EF9F1B"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7E2"
FT                   /transl_table=1
FT                   /translation="MDTIEPSGESRPEKSSSVGDEYRTFVRSNTNADVTMSTARLNEMV
FT                   EAAPGTDDEKLLCSRQFLRKHIFTKECDTNMISYPVHVAAESNNASVGNRTDDAEGQFN
FT                   HRKRCSMLRLKMSISISRWLRLSHPARINRRTPVLRLMRYHLGPLKTGETLQNVSASET
FT                   GWMMSCTVARSEASSGCGYLCRIQQIDRSPAIKLTPHRGAGI"
     atggacacga ttgagccatc tggcgagagt cgacctgaga aaagttcaag cgttggagat        60
     gaatatcgaa ccttcgtccg ctccaacact aatgcagatg ttaccatgag taccgcccgg       120
     ctgaacgaga tggtggaagc tgcgcctggt actgatgatg aaaagcttct ctgcagtcgc       180
     caatttcttc gcaagcatat tttcaccaag gagtgtgata ccaatatgat ctcataccct       240
     gtgcacgtgg ctgctgaaag caacaatgcc tcagtaggca accggactga tgatgctgag       300
     gggcagttca accaccgcaa gaggtgctcg atgcttcggt tgaagatgtc catctcgata       360
     tcgagatggc tacggttaag ccatccggcg agaattaaca ggagaacgcc ggtcctgaga       420
     ctgatgcgat accatttggg tccattgaag actggcgaaa ccctgcagaa tgtttccgct       480
     tctgaaaccg gctggatgat gagttgcacg gttgcaagat cggaggcttc aagtggatgc       540
     gggtacctgt gtcgcattca acagattgac aggtctccag cgataaagct cacacctcat       600
     cgcggtgctg gaatctag                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page