(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE321

ASPNC_1.PE321        Location/Qualifiers
FT   CDS_pept        join(complement(815147..815217),complement(814577..815075))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211268" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877848"
FT                   /orf_name="An01g03390"
FT                   /product="Similarity to hypothetical protein CAD21197.1 -
FT                   Neurospora crassa"
FT                   /protein_id="CAK36878.1"
FT                   /db_xref="HOGENOM:HBG329876"
FT                   /db_xref="InterPro:IPR007529"
FT                   /db_xref="UniParc:UPI0000EF9D9F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q881"
FT                   /transl_table=1
FT                   /translation="MPGTCEVCVSEPSKYRCPTCGLMSCSLACTQSHKIYCAPKAPSPK
FT                   PTGPTVDIQQPPGESNEHAASEITPKAQNGLDIKALGSSTELKDLLDRFPSLREELYDI
FT                   YKTTLEDAWVETQRFGGRGRHHGRGKGPHRHNGPWTREKGFNRGVGRVRRLRERCEEGL
FT                   ETGKKAEGYVRFMSLVTGNELPRETM"
     atgcccggca cttgcgaggt ttgcgtctcg gagccttcga agtaccgatg cccaacatgt        60
     gggctcatga gttgctctct ggcttgcacc cagtcccata aaatctactg cgcacctaaa       120
     gcaccatcgc caaaaccgac cggtccaacg gtcgacatcc aacagcctcc cggcgaatcg       180
     aatgagcatg cggccagcga gataacacct aaagctcaga atggcctcga tattaaagcc       240
     ttaggaagct caaccgaact caaagattta ctcgatcggt tcccttcgct tcgtgaggag       300
     ctgtacgata tctacaagac tactttggaa gatgcatggg tggagacaca acgctttgga       360
     ggtcggggtc gacaccacgg gagaggcaaa gggccgcacc gtcataacgg gccgtggacc       420
     cgtgagaagg gcttcaaccg gggagtggga agggtgagga ggctacggga aagatgcgag       480
     gagggcctgg agactggaaa aaaagcggag ggatacgtgc gtttcatgtc cttggtcact       540
     ggtaatgagc ttccacgcga gaccatgtga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page