(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE327

ASPNC_1.PE327        Location/Qualifiers
FT   CDS_pept        join(831046..831132,831358..831514,831575..831801,
FT                   831876..832016)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000229584" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877852"
FT                   /gene_name="rpl15"
FT                   /orf_name="An01g03460"
FT                   /product="Cytoplasmic ribosomal protein of the large
FT                   subunit L15 rpl15-Aspergillus niger "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAK36884.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG577798"
FT                   /db_xref="InterPro:IPR000439"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR020925"
FT                   /db_xref="UniParc:UPI0000133BFA"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q887"
FT                   /transl_table=1
FT                   /translation="MGALKYVEEIQKKKQSDVIRFLLRVRCWELRQLNAIHRASRPSRP
FT                   DKARRLGYKAKQGYVVYRIRVRRGGRKRPAPKGATYGKPTNMGINQLKYQRALRATAEE
FT                   RVGRRCANLRVLNSYWINQDSTYKYFEVILVDPQHKAIRRDARINWICNAVHKHREARG
FT                   LTATGKKSRGINKGHRYNNTRSGRRHTWKRQNTQSYWRYR"
     atgggtgccc tcaagtacgt ggaagagatc cagaagaaga agcagtccga cgtgattcgc        60
     ttcctgctgc gtgtccgttg ctgggagctc cgtcaactga acgctatcca ccgtgcttcc       120
     cgcccttctc gccccgacaa ggctcgtcgt ctcggctaca aggccaagca gggctatgtt       180
     gtctaccgta tccgtgtgag acgcggtggt cgtaagagac ccgctcctaa gggtgccacc       240
     tacggcaagc ccaccaacat gggtatcaac cagctcaagt accagcgcgc tctccgtgct       300
     accgctgagg agcgtgttgg ccgtcgctgc gccaacctgc gtgtcctgaa ctcctactgg       360
     atcaaccagg actccaccta caagtacttc gaggtcatcc tcgtcgaccc ccagcacaag       420
     gccatccgcc gcgatgctcg catcaactgg atctgcaacg ctgtccacaa gcaccgcgag       480
     gcccgtggtc ttaccgccac cggcaagaag tcccgtggta tcaacaaggg ccaccgctac       540
     aacaacaccc gctctggccg ccgccacacc tggaagcgcc agaacaccca gagctactgg       600
     cgttaccgtt aa                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page