(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE330

ASPNC_1.PE330        Location/Qualifiers
FT   CDS_pept        join(839882..840294,840368..840896)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211290" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877854"
FT                   /orf_name="An01g03490"
FT                   /product="Similarity to hypothetical protein CAE76442.1 -
FT                   Neurospora crassa"
FT                   /protein_id="CAK36887.1"
FT                   /db_xref="HOGENOM:HBG329882"
FT                   /db_xref="InterPro:IPR008999"
FT                   /db_xref="InterPro:IPR010414"
FT                   /db_xref="UniParc:UPI0000EF9DA7"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q890"
FT                   /transl_table=1
FT                   /translation="MVKPLTFKGDKPKKRKHTSTSTSTDPSHPAKKQSTSTSTPTANEA
FT                   EDPSTHDEHTLSDQSWVSADTSSDISGPILLILRTTPPTCLATDAHGTVFASALENMIE
FT                   GDPRTAEPHDVRQVWIASKIAGIEGWSLKGSNGRYLTSDKHGILSANASAISQHEIYTI
FT                   SESGAGGGGFFVFGTGTGASSASQGGDGVDDKEKKEKKQTYLVARTVASKTTASGTKVE
FT                   IRGDETTLDDGEEDGGGTNIRVRMQARFKPRIQASKEIKAREKIGRKELEGIVGRRLDD
FT                   DEVKRLRKARKEGDFHEVVLDVRVRGKHDKFA"
     atggtaaagc ctctaacctt caaaggcgac aagcccaaaa aacgcaaaca cacctccaca        60
     tcaacctcca ccgatccctc ccatccagcc aaaaaacaat ccacatcaac cagcacccca       120
     accgccaatg aagccgaaga cccctcaacc cacgatgaac acaccctctc cgatcaatcc       180
     tgggtctccg ccgacacaag cagcgacatc tccggcccaa tcctgctcat cctccgcacc       240
     acaccaccca cctgcctcgc gaccgacgcg cacggcaccg tcttcgcctc tgcgctcgag       300
     aacatgatcg agggggatcc ccggaccgcg gaaccccatg atgtgcgaca ggtttggatt       360
     gcgagtaaga ttgctggcat tgaggggtgg agtttgaagg gatcaaacgg gcgatacttg       420
     actagcgaca agcacggcat cttgtccgcc aatgcatcgg ctatttcgca gcacgagata       480
     tatacgatta gtgagagtgg ggcgggggga ggagggttct ttgtctttgg gaccgggacg       540
     ggagcgtctt ctgcttcgca ggggggtgat ggcgtggatg ataaggagaa gaaggaaaag       600
     aagcagacgt atcttgttgc gcggactgtt gcgtcgaaga cgactgcttc ggggacgaag       660
     gttgaaattc gtggggatga gactactctt gatgatgggg aggaggatgg gggagggacg       720
     aatattcgtg tgcgcatgca ggcgcgcttc aaaccgcgca tccaagcgag taaggagatc       780
     aaggcgcggg agaagatcgg gagaaaggag ttggagggta ttgtggggag acggttggat       840
     gatgatgaag tcaagaggtt gaggaaggcg aggaaggagg gcgattttca tgaggtcgtg       900
     ttggatgtta gagtgagagg gaaacatgat aagtttgctt ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page