(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE334

ASPNC_1.PE334        Location/Qualifiers
FT   CDS_pept        complement(848525..849439)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211334" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877858"
FT                   /orf_name="An01g03530"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36891.1"
FT                   /db_xref="HOGENOM:HBG329886"
FT                   /db_xref="UniParc:UPI0000EF9DCB"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q894"
FT                   /transl_table=1
FT                   /translation="MHKPSLAQIVHSTLFPRPRASDPATFSAHITRNLVPEVRVETSTF
FT                   YGSLDCPEAQYPGLDYSYGPHRMRLGRFPWHRRLFRAFDELGLTETEISSLCRWEGTKS
FT                   ARERYEKEEGVKVRDTTADNIRPASPSPLPSIEVHYEDETEEEEEEELLPEPEYPVVTF
FT                   ETVRSTSSLIDDRGIDCIVEEKEEEDSSDDEMESCGVELNHRLIAATAAREQGADVSLD
FT                   EDWEQWLKEAGERGSYTDVLSAIRMGQPLGYLYDTSPPMPPLGRVGGRSSASLSEPFVL
FT                   PTPSMLSSRGIQRYAHSSSRTAR"
     atgcataagc cttcactggc ccaaatagtg cacagcacat tatttcctcg cccgcgcgca        60
     agtgatccgg ctacattctc cgcacatatc acccgcaacc tggtcccaga agttcgagtc       120
     gaaacgtcca cattctatgg atcgcttgac tgccccgagg ctcagtatcc gggacttgac       180
     tattcctatg gtccgcaccg catgaggctc ggtcgttttc catggcaccg aagactgttc       240
     cgggcctttg acgagcttgg tcttacggag accgagatct catccctatg ccgctgggag       300
     ggcaccaagt cggctcgcga acgttacgag aaggaagaag gcgtgaaagt ccgcgatact       360
     acggccgaca atattcgacc cgcttctcca tctcctcttc catcgattga agtccactat       420
     gaggatgaga cggaggagga agaagaagaa gaactcttgc cagaaccgga atacccagtg       480
     gtgacatttg agaccgtgcg ctctactagc agcctgatcg atgaccgggg gatcgattgc       540
     attgtggaag agaaagagga ggaagattca agcgatgacg aaatggagag ctgcggagtc       600
     gagctgaatc atcgcctcat agcagcgacc gcagcccgcg agcagggggc cgacgtgtca       660
     ctggacgagg attgggagca gtggctgaag gaagccgggg agcgagggag ctacacagat       720
     gtgctcagtg cgatccgtat gggtcagcca ctgggttacc tatacgatac gtctcctcca       780
     atgccgcccc tcggaagggt cggcggtcga tcatctgcct cactttcaga gccattcgtt       840
     ctgcccaccc cgtccatgct gtcgagtcgg ggcatccagc gctatgctca ttcgtcgtca       900
     cggacagccc gatag                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page