(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE343

ASPNC_1.PE343        Location/Qualifiers
FT   CDS_pept        join(complement(872593..872604),complement(872452..872502),
FT                   complement(872282..872399),complement(871912..872126))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877863"
FT                   /orf_name="An01g03620"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36900.1"
FT                   /db_xref="UniParc:UPI0000EF9DD4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8A3"
FT                   /transl_table=1
FT                   /translation="MPGAQVSIPYRQNTGKRDTTWNTTLHLDQSILHETQLPRCIQPQL
FT                   NRSSALPQGPYGRSRGGQALFSPGLLKGGNSSEKKTNLEYYPDELTNGQQQDCLRTLNR
FT                   LQNLKAWHLFFQKFLPDPKTKESGQTR"
     atgcctggag cgcaggtctc aattccatat agacagaaca caggaaagcg tgatactact        60
     tggaacacta cactacatct agaccaatca attttgcatg aaacgcagct gcctaggtgc       120
     attcagccac aactcaatcg ttcctcagca ctgccacaag ggccctacgg gagaagccgt       180
     ggtggtcaag ctctcttctc tccaggcctc ctcaagggag gcaacagcag tgaaaagaag       240
     accaatctcg agtactaccc agatgaacta acaaatgggc aacagcagga ctgtctacgc       300
     actcttaacc gcctccaaaa tttgaaggca tggcatcttt tttttcaaaa attcctcccc       360
     gatccgaaga ccaaggagag cggtcaaact aggtag                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page