(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE364

ASPNC_1.PE364        Location/Qualifiers
FT   CDS_pept        join(complement(915057..915097),complement(914652..914848),
FT                   complement(914422..914539),complement(914167..914320))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111061"
FT                   /orf_name="An01g03840"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36921.1"
FT                   /db_xref="UniParc:UPI0000EF9E14"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8C4"
FT                   /transl_table=1
FT                   /translation="MYASTSTNAVLKPRSHSGLSEVMTLKGCLLYALQLHSSSASGEPV
FT                   LIGRHVRRTLPTAVASMWLPASGSGMASMGRISAGTRIGLVVLPLLAVDYPCLKHHFVG
FT                   ADLPDCGVESRSNPSEGLRDSWASGASEPRFVVDQSTLWLIEIRNNDNYTTLAIRKNQV
FT                   QKGTSH"
     atgtatgcaa gcacaagcac caatgcggtt ctcaaaccaa ggtctcactc aggcttgtct        60
     gaagtcatga cactaaaggg ctgtcttctc tacgctttac aactacactc tagctcagcg       120
     agtggagagc ccgttctaat tggtcgtcat gtcaggagaa ctcttccaac ggctgtcgcg       180
     tctatgtggc tgcctgccag cggttctgga atggcatcca tgggccggat ctctgctggg       240
     acacgcatag ggctcgtggt tttgcccctt ttagccgtag actatccgtg cctaaagcat       300
     cacttcgtcg gagctgacct gcctgattgt ggagtggagt cgagatctaa tccaagcgaa       360
     gggttaagag actcatgggc cagtggagct tcagagcctc gctttgtagt cgatcaaagt       420
     acactgtggc ttattgagat caggaataac gacaattaca ccacactagc catacgtaaa       480
     aaccaagtgc aaaaagggac atcacattaa                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page