(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE37

ASPNC_1.PE37         Location/Qualifiers
FT   CDS_pept        join(100703..100995,101097..101732,101786..101903)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110315"
FT                   /orf_name="An01g00420"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An01g01580 - Aspergillus niger"
FT                   /protein_id="CAK43431.1"
FT                   /db_xref="UniParc:UPI0000EF9F1F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7E7"
FT                   /transl_table=1
FT                   /translation="MEVAVTHLRTLVGLATRTDPSPLPPVQDIISHIQSLYDSGRPFYT
FT                   KDLLQCIKEQLRGARDGIIQTIRVPGVDEVIVEFPVMTGQVFPTPEQGMELIVRNPCIE
FT                   YLSVQELLQDCDLRDDNLAYNHIQIGHYRFLRNIHTKELYSDLSVASVPDASELLRRSS
FT                   RIWENTAQCQALRAILMSRKDISISRIVGLALGSFATVYPSLQDRSAFQHALLLTLRDI
FT                   SCNMQNIAQQSIPCFAQDPMCNIVDITAAEEAGITILEDTDGFLEIDDSTVVFSCAPDI
FT                   PVRQIVLDLARPAVLIWDKLRNEDDDDHSADPASPRVMTCLRNIYEEFEFPDYDKHFGD
FT                   LAVYIRRN"
     atggaagtag cagtcacgca tcttcggact ctggtggggc tcgcaacgcg tacagatcca        60
     tcgcccctac cccccgtcca ggatataata tcccatatcc agtcgttata tgactctggc       120
     aggcccttct acaccaagga tttactccag tgtatcaaag agcaactccg gggtgctcgt       180
     gatgggatca ttcaaactat ccgtgtgccc ggagtggatg aggttattgt tgagtttccg       240
     gtaatgacag ggcaggtttt cccgacacca gagcaaggaa tggagttaat cgtccgaaac       300
     ccctgcattg aatatttatc tgtgcaggaa ctgcttcaag attgcgatct gagggatgat       360
     aatctggcct acaatcacat ccagatcggt cattatcgct ttctgcggaa tattcacacc       420
     aaggagcttt actcagacct ttcagtggct tcggtacctg atgcaagcga gcttcttcga       480
     agaagttcgc gtatctggga gaacaccgca cagtgtcaag ctcttcgggc aatacttatg       540
     tcacgaaagg atatctctat atccaggatt gtggggcttg cgctcgggtc tttcgcaacc       600
     gtttacccta gtctgcaaga tcgatcagct ttccagcatg cccttctatt gactctgcgt       660
     gatatatctt gcaatatgca aaatatagca cagcaatcta ttccgtgttt tgcccaagac       720
     ccgatgtgca acatagttga tatcaccgcc gctgaagagg ctggaatcac gattctggaa       780
     gacactgacg gatttcttga aattgatgat tccacggtgg tattctcatg cgccccagac       840
     attcccgtaa ggcagattgt tctggatcta gctcgacctg ccgtcctcat atgggacaaa       900
     ttgaggaatg aagatgatga tgatcactcg gccgaccctg cctctccacg tgtgatgact       960
     tgcctacgga acatctatga agaattcgaa tttcctgatt atgataagca ctttggcgac      1020
     ctggcagtat acattcgtcg gaattag                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page