(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE370

ASPNC_1.PE370        Location/Qualifiers
FT   CDS_pept        join(complement(926270..926482),complement(926033..926182))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806937"
FT                   /orf_name="An01g03910"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36927.1"
FT                   /db_xref="UniParc:UPI0000EF9E1A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8D0"
FT                   /transl_table=1
FT                   /translation="MARKHCEYTITYGYGRSNNLQQGEFEIKHKELLNEVFIHSTALWN
FT                   VSFTARYLLITRVFICGTAIPNPRRPPKWIPYRGLIVDHRRVGGPISRDRVGGLGVASR
FT                   QYFPSLLSLGPGTTPA"
     atggcccgga agcactgtga gtatacaatt acttatggat acggaagaag caacaacttg        60
     cagcaaggag agtttgagat caaacataag gagttactaa acgaagtctt catacacagt       120
     acagccctct ggaatgtaag cttcaccgca aggtatctac ttattactcg ggttttcata       180
     tgtgggacgg caatcccgaa tccacgacgg ccgcccaaat ggataccata tcgtggattg       240
     atagttgatc accggcgcgt cggagggccg atcagccgtg accgagtcgg tgggttgggc       300
     gtcgcgtccc gccaatattt cccttccttg ctctcattag gccctgggac aactccggca       360
     tag                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page