(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE381

ASPNC_1.PE381        Location/Qualifiers
FT   CDS_pept        join(complement(949208..949268),complement(948985..949125),
FT                   complement(948647..948730),complement(948222..948467),
FT                   complement(947999..948129),complement(947566..947733),
FT                   complement(947207..947323),complement(946910..946965),
FT                   complement(946712..946865),complement(946434..946496),
FT                   complement(946010..946069),complement(945809..945907),
FT                   complement(945543..945640),complement(945181..945440),
FT                   complement(944542..944768))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877881"
FT                   /orf_name="An01g04020"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36938.1"
FT                   /db_xref="UniParc:UPI0000EF9E33"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8E1"
FT                   /transl_table=1
FT                   /translation="MHSRYRSIVALIDPEGGNEGCPRKGEERQVCGQEMDLRLLQRLAA
FT                   QRAPEEEDASKEFRRCNVLAVLAKRRAGKKAQPQRVNDDSQGKRGGRAAPGGRETLSPT
FT                   NPAKPRPTLSFSSPNPCMLRFLRLRDAGQYQYLGILYAPVNTQPSCYLLVGNYRQAKTP
FT                   SWREEAPSHKGLEKRVTGFVTSRFHPWGKPAPKYKKQKTMRHFGGWLPRRANLDLTNPS
FT                   KERLSDKEGGYSMRRNEPPRGQDSAGARAGIIAARAATVVCGKVALPTVGAGNARVPRR
FT                   SYLFRLIRSVAAPGIHTTHHHPTYSIHSTPNQTNMLGLNLVVPDPESDGLGPVTLSQSE
FT                   AVVTSTVGASRVMPMMRARTTNLPACYRHHWELRTNCKRSLDDSIPRLAMGQAGGFHVF
FT                   NLPRSPLKPSSCLPPGNSTVIIPGMVTQAFPTRKAQHVQRVAVMESVRGKKEAGKPIGI
FT                   GLIVSGRMETRKREKKQYGDDDQIHARWQSNWDKRVAISKAETIERANSTPSTTNGLTI
FT                   KKPAHPRSLRMGGAARLLNASRSLQVLGQASCDSGITPTQCHGCSGRCSFPQSQQPICA
FT                   SREFLSEGSSSMTANTDSPHLDREQDTRYMLLMYTYVPNTSGICATRPRSQDRNRLSAN
FT                   KLRPSTERKNRIRNINYIQ"
     atgcactctc gttatcgatc aatagtagca ctgatcgacc cagagggcgg aaatgaaggg        60
     tgtccaagaa aaggagaaga gcgtcaggta tgcggccaag agatggactt acgccttctt       120
     caaagattgg cagctcaaag agcgccagaa gaagaagacg cgtcgaaaga gtttcgcagg       180
     tgcaatgtgt tggcagtgct agccaaaagg agggcgggta aaaaggcgca gcctcagcga       240
     gtaaatgacg attcgcaggg taaaagaggc gggagagcgg cgccaggcgg acgagagacg       300
     ctcagtccaa ccaaccccgc caagcccaga cccaccctgt cgttttcctc gccaaatcca       360
     tgcatgcttc ggttcctgcg gctacgtgac gctggccagt accaatacct tggtattctt       420
     tacgctcccg tcaatacaca gccgtcatgc tacttactag taggcaatta ccgtcaagca       480
     aaaaccccgt catggaggga agaggctccg agtcataaag gattggagaa gagagtcacc       540
     ggttttgtaa cgagccggtt tcatccatgg ggcaagccag caccgaagta caaaaagcaa       600
     aagactatga ggcattttgg aggttggcta ccaaggcggg ctaacctcga tcttactaac       660
     ccgagcaaag aaaggctgtc agacaaggag ggcggctact caatgagaag gaatgaaccc       720
     ccacgaggac aagacagcgc aggagccagg gcaggcatca tagcggcacg agctgctact       780
     gttgtgtgtg ggaaagttgc cctaccgacc gtcggggcgg gtaatgccag ggttcctcgg       840
     cgtagctacc tcttccgact gattcggtcg gtcgcagctc caggaataca caccacacac       900
     caccacccta cctactccat acacagcaca ccaaaccaga ctaacatgct gggcttaaat       960
     ctggtggttc ctgatccgga aagcgatggt cttggccctg tgacgttatc tcagtctgaa      1020
     gcagtagtta ccagtaccgt aggagcatct cgtgtgatgc cgatgatgcg ggccagaacg      1080
     acaaacttgc ctgcttgcta cagacatcac tgggaactgc gaaccaactg caagagaagt      1140
     ctcgacgatt ctatcccacg actggcaatg ggacaagcag gtggtttcca tgtcttcaat      1200
     ctgccacgct cacctctcaa gccgagttct tgtcttcccc cgggtaactc cacagtgatc      1260
     atcccaggga tggtcaccca ggcattcccg acaagaaagg ctcagcatgt tcagcgagtg      1320
     gcagtgatgg aaagtgtgag agggaaaaag gaagcaggaa aacccatcgg gatcggcctg      1380
     attgtctccg gaagaatgga gacaaggaag agggaaaaaa agcagtatgg cgatgatgac      1440
     cagatccatg cccgatggca aagcaactgg gacaagcggg tagcgatctc caaagcggag      1500
     accatcgagc gggctaattc caccccatcc accaccaacg ggcttacaat caaaaaacct      1560
     gcacatccac ggtcgctgag gatggggggt gcagctagac tgctaaacgc ctcgcgaagc      1620
     cttcaagtgc tgggacaagc ttcatgcgat tcagggataa cccccactca gtgccatggc      1680
     tgctccggga gatgcagctt cccacaatcg cagcagccaa tctgcgcgtc tcgggaattc      1740
     ctctccgaag gatcctcatc catgaccgcc aacacggact ctccgcactt ggatcgagaa      1800
     caagatacaa ggtacatgct acttatgtac acttatgttc cgaatacatc tggtatatgt      1860
     gctacgcggc ctagaagcca agatcgaaac agactttccg caaataaact ccgaccgtcg      1920
     acggaaagga aaaacagaat aagaaatata aactatatac aatga                      1965
//

If you have problems or comments...

PBIL Back to PBIL home page