(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE383

ASPNC_1.PE383        Location/Qualifiers
FT   CDS_pept        join(952476..952494,952653..952756,952920..952959,
FT                   953062..953127,953203..953502,953567..953607)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000163690" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877882"
FT                   /gene_name="sar1"
FT                   /gene_synonym="sarA"
FT                   /orf_name="An01g04040"
FT                   /product="Small COPII coat GTPase SAR1 "
FT                   /EC_number="3.6.5.-"
FT                   /function="GTP binding"
FT                   /function="hydrolase activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="ER to Golgi transport vesicle membrane"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="CAK36940.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0012507"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006687"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="UniParc:UPI0000EF9E35"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C951"
FT                   /transl_table=1
FT                   /translation="MWLINWFYDLLASLGLLNKHAKLLFLGLDNAGKTTLLHMLKNDRV
FT                   AILQPTAHPTSEELAIGNNRFTTFDLGGHQQARRLWKDYFPEVSGIVFLVDAKDHERFP
FT                   ESKAELDALLAMEELAKVPFLILGNKIDHPDAVSEDELRHQLGLYQTTGKGKVPLEGIR
FT                   PIEVFMCSVVMRQGYGEGIRWLSQYV"
     atgtggctca ttaactggtt ctacgatctc ctggcctccc ttggcctgct caacaagcac        60
     gccaagctcc tgttcctcgg tctcgataat gccggaaaga cgaccctcct gcacatgctg       120
     aagaacgacc gggttgccat cctccagccc actgctcacc cgacatccga agaactcgcc       180
     atcggcaaca accgcttcac gaccttcgac ctgggtggtc accagcaggc tcgtcgtctg       240
     tggaaggact acttccccga agttagcggt atcgtcttcc tcgttgacgc caaggaccac       300
     gagcgtttcc ccgagtccaa ggccgagctc gacgctctcc ttgccatgga ggagctggct       360
     aaggttcctt tcctgatcct cggaaacaag atcgaccacc cggatgctgt tagcgaggat       420
     gagctgcgcc accagcttgg attgtaccag accacgggta agggcaaggt tcctctcgag       480
     ggaatccggc ccattgaggt gttcatgtgc agtgttgtca tgagacaggg atacggtgaa       540
     ggtatcagat ggctgtctca atacgtctaa                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page