(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE385

ASPNC_1.PE385        Location/Qualifiers
FT   CDS_pept        join(complement(960021..960289),complement(958923..959937),
FT                   complement(958034..958874),complement(957769..957984),
FT                   complement(956837..957717))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211033" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18960200"
FT                   /orf_name="An01g04060"
FT                   /product="Function: TFC4 of S. cerevisiae is a subunit of
FT                   transcription factor tau"
FT                   /function="binding"
FT                   /protein_id="CAK36942.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG329922"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0000EF9E37"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8E5"
FT                   /transl_table=1
FT                   /translation="MDYPDDHHPHHQPPSQEYVYPDIDETIHYPWQGNQPTTQGEASIH
FT                   SVLDPRLYKDLFTGNASQAQDEASLDEDAEAYHDADDSDESLYTFEEEFSNQADEDDEA
FT                   YGRRRRRGTGPFSGRYGARGGKGIRRGPRKPLEPSPEFKILHSEATSAFIDGDYDRAID
FT                   LTKRAIQVNPEMFAAHSLLSEIFLAQGEKDKALTALFSGAHTRPKDPTVWAKVARMILE
FT                   RAGEERQGALNDVIYCYSRIIELDPKNYNARFQRAAIYRELGYNGRAATEYERILKEVP
FT                   HNARALRHLAETYIDLNDVQKAVDQWRVSVKYFTSLEPEDAPEFSWSDVNIYAELYSYL
FT                   GRPFEGLKALKSVSRWLLGRKDDTMWEDFHEDDREWDADDSPRRIKADGYEPRRWPRDS
FT                   YGLGLPLELRIKLALFRLRMGYEHKNEALKLQHHLEWLNPEDTSEHARLYDYGDLFREA
FT                   ADALKDVGLFEEALRFYMPLQQTNEYADVGFFMAMGECCSVLGKLEDAENCFLTVAEHD
FT                   ARHVESRVQLAKLYEGIGMSEEALKYVNEAVLLGRQESRSNRRRKDTRLEQLAVEFKAA
FT                   DAAREDAALRSIAPQPPSADLPAALTTTTTSAAKDTEINEEQRIANVQYLYDKLMQLLP
FT                   QAKEGNAEATEDWLDIADALLREFRSNRVFYPIQRNITFLGYSREAQRKAGRHKGRNFI
FT                   DEMQEMAGRLQESLGSIPDEPLQGAIPTDYYGISFNEWLDLFLQYALTVATQGESDEAY
FT                   DTLAAAADASVWYHSKADTRMIHVCWFTCALRMQDEETLANEARWFIKEYQFVTDTYRL
FT                   FAMLSRLVGDPHRSLFHSSPNMKFMLRQIKAMDFTVPDEVTGERPNRFVRESAYKERAS
FT                   LSTRDETTGEAIPADEMDVALLVLYGHILYSGNSFYPALNYLFRAYALDDQNPAVLLSI
FT                   ALCYIHHSLKRQSENRHYLIMQGLSFMQEYRRVRERPGSLLSERQEMEFNFARVWHSLG
FT                   IAHLAIEGYQLVLDLGAQIQAQSQQTIPHPKDGSDVVMGDTGLEAQAPFVEDFSREAAV
FT                   ALQIIYALNGDYQSAQKVTAKWLVI"
     atggattacc cggacgacca tcacccacat caccaacctc cctcgcagga gtacgtctat        60
     cccgatattg atgagacgat acattaccca tggcagggaa atcagccaac cacgcaagga       120
     gaggcctcca ttcactccgt tctggatccg cgcctgtata aggacctttt tacaggtaac       180
     gcctcacagg ctcaagatga ggcttccttg gatgaggatg cagaggcgta tcatgatgcg       240
     gacgactcgg acgagtccct ctatacattt gaggaagagt tctctaacca ggctgatgaa       300
     gacgacgaag cctacggtcg gagacgtcgc aggggcacag gccccttctc tggtcggtac       360
     ggtgcgcgcg gtggaaaggg catcaggaga ggaccgcgca aaccactaga accgagcccc       420
     gagttcaaga tcttgcattc ggaggcaacc tctgccttca tcgatggtga ctatgaccgt       480
     gccattgatc taacaaagcg tgccattcag gttaaccccg agatgttcgc ggcgcattcg       540
     ctcttgtccg aaatcttctt ggcccaaggc gagaaagaca aagcattgac cgcgttgttc       600
     agcggcgctc acacgcggcc caaagatcct acagtatggg ctaaagtagc aaggatgatc       660
     ctcgaacgcg ccggggagga acgtcaaggt gcactgaatg acgttatcta ctgctatagc       720
     cgtatcattg agctagatcc gaagaattac aatgcccgat tccagcgagc agcgatctac       780
     agagaattgg gctacaatgg acgagcagcg acagagtatg agcgcatctt gaaagaagtc       840
     ccacacaacg ctagggcgct tcgacacctg gcagaaacct acatcgacct caacgatgtc       900
     cagaaagccg tggatcagtg gcgggtgagc gtgaaatact tcacgtctct agaaccggaa       960
     gatgctcccg aattttcttg gtccgatgtc aacatctacg ccgaactgta cagctatctg      1020
     ggccggccgt ttgagggcct caaggccctc aagtctgtct cgagatggct tctaggccgg      1080
     aaggatgata cgatgtggga ggattttcat gaagacgacc gggaatggga tgcggatgat      1140
     tctcctcgac gcatcaaggc tgatggatac gaacctcgaa ggtggcctcg agattcgtac      1200
     ggtctcggtc tacccctgga gttgcggatc aagctggcac tctttcggtt gaggatgggt      1260
     tatgagcaca agaacgaagc tctgaaacta cagcatcacc tcgagtggtt gaacccggag      1320
     gatacgtccg aacatgctcg gttgtacgat tatggcgacc ttttccgaga ggccgctgat      1380
     gcgctcaaag acgttgggct tttcgaagag gcactgcggt tctacatgcc cctccaacaa      1440
     acaaacgagt acgcagatgt cggcttcttc atggcaatgg gagaatgttg cagtgtattg      1500
     ggcaagctcg aagacgccga gaactgcttt cttacggttg cggagcacga tgcacggcac      1560
     gtggaatccc gcgtgcagct ggcaaagctt tatgagggca ttggcatgtc ggaagaggct      1620
     ctgaaatacg tcaatgaagc ggttctgcta ggaaggcagg agagccgtag taaccgccgg      1680
     cgcaaggaca caaggctgga acagctggcg gtggagttca aggcagctga tgcggctcgt      1740
     gaagacgctg ccttgaggtc aatcgcgcct cagcccccaa gcgctgacct gccggctgct      1800
     ctgactacta ctactacctc agctgcaaag gatacggaga taaatgaaga acaaaggata      1860
     gcaaatgtgc aatatctcta tgacaagtta atgcagctgc ttccgcaagc gaaagaaggc      1920
     aacgcagaag ccacggagga ctggctggat atagcagacg ctttgctgcg tgaatttcgg      1980
     tcaaatcgag tattctatcc cattcaacgc aacataacct tcttgggata ttcgcgcgaa      2040
     gcacagagaa aggcggggag acacaagggc cgcaacttca tcgatgagat gcaagaaatg      2100
     gctgggcgtc tccaggagtc tttagggagt attcctgacg agccacttca aggggctata      2160
     ccaactgact actatgggat cagcttcaat gaatggctcg accttttctt gcagtatgcc      2220
     ctcactgtag cgacgcaagg agaatccgac gaagcgtacg acacgctcgc agccgctgcg      2280
     gatgccagcg tctggtatca ctccaaagcc gacacccgca tgattcatgt ttgctggttc      2340
     acttgtgcgc ttcggatgca ggatgaagag acgcttgcaa atgaagcacg atggtttatc      2400
     aaggaatatc aattcgtaac tgatacttat cgcttgtttg ccatgttgag ccggctcgtc      2460
     ggtgatcctc accggtcttt gttccactcg tcaccaaaca tgaagttcat gctgcgccag      2520
     atcaaggcca tggactttac tgtaccggac gaggttacag gagaacgacc aaatcggttc      2580
     gtgcgcgagt cagcttacaa ggaacgcgca tccttgtcta cgcgggacga gacgactggt      2640
     gaagccatcc cggcagatga aatggacgtt gccctgcttg tgctatacgg ccacatcctt      2700
     tactcgggaa acagtttcta cccagccctg aattacttat tccgcgccta tgcactggac      2760
     gatcagaacc cagccgtcct gctctccatc gccctctgct acatccatca ctcactcaag      2820
     cgccagtccg aaaaccgaca ctacctcatc atgcaggggc tgtcgttcat gcaggagtat      2880
     cgacgcgtcc gtgaacgacc aggaagtctc ctatcggaac ggcaagaaat ggaattcaac      2940
     tttgctcgcg tctggcatag cttagggata gcccatctag caatagaagg ctaccagctc      3000
     gtgctagatc tcggcgcaca gatccaagcg caatcccaac aaacgatccc gcacccgaaa      3060
     gatggcagcg atgtcgtcat gggcgataca gggctagaag cgcaagcccc tttcgtagag      3120
     gacttttcgc gcgaagcggc ggtggcgctg cagattatct atgccctgaa cggcgattat      3180
     caatcagccc agaaggtcac ggccaaatgg ctggtgattt ag                         3222
//

If you have problems or comments...

PBIL Back to PBIL home page