(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE388

ASPNC_1.PE388        Location/Qualifiers
FT   CDS_pept        join(964270..964278,964378..965058)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877885"
FT                   /orf_name="An01g04090"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36945.1"
FT                   /db_xref="UniParc:UPI0000EF9E3A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8E8"
FT                   /transl_table=1
FT                   /translation="MALKVVTHQRRNQPAIYSNSDIMLPTYLAIYQLITTTNTIIHPPT
FT                   VHHPKPHNQKQSKCHPQNKNSLSSSTPSSRNLSNTTTGCVKPSPKPTNLLRTLSLTIPP
FT                   ILIPQTLSSLHSLTSFLLGLTAGILSLQSATGFLFYLLGTVFVSALFHALLLYRSGGLG
FT                   AGMYFAGANGEVEGMDERGVVSGKGTKGGGMLRRAAWRDVWFGGGVLSEALSGFILGWA
FT                   GVGGVLR"
     atggctttga aagtagtaac ccaccaaagg cggaaccaac cggcaatata ctccaactcc        60
     gacatcatgc tacctaccta cctagctatc taccaactta tcaccacaac caacaccatc       120
     atccatccac ccacagtcca ccatccaaaa ccacacaatc aaaaacaatc aaaatgccac       180
     ccacaaaaca agaactctct ctcctcatca accccctcgt cccggaatct ctccaacaca       240
     acaacagggt gcgttaaacc ctcccccaaa ccaaccaacc tcctacgaac cctctcacta       300
     acaataccac ctattttaat cccacagaca ttatcttcat tacactccct aacctccttc       360
     ctcctcggcc tcacagccgg aatcctctcc ctgcaatccg ccaccggatt cctcttctac       420
     ctcctcggca cggtcttcgt gtccgcgctg ttccacgccc tgctactcta tcgctccggg       480
     ggattaggcg cggggatgta ttttgcgggt gcgaatggag aagttgaggg gatggatgag       540
     aggggtgtgg tcagtggtaa gggtactaag ggaggtggta tgttgagacg cgcggcctgg       600
     agggatgttt ggtttggggg tggtgtgctg agtgaggcgc tgagtgggtt tatcttgggg       660
     tgggcgggtg ttgggggggt tttgaggtga                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page