(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE392

ASPNC_1.PE392        Location/Qualifiers
FT   CDS_pept        join(970825..971096,971182..971228,971328..971443)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654278"
FT                   /orf_name="An01g04130"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36949.1"
FT                   /db_xref="UniParc:UPI0000EF9E3E"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8F2"
FT                   /transl_table=1
FT                   /translation="MKAKRVDNGEMRLAGFERRKISLGERLLLDGAVAKNSSRRRERNG
FT                   VGWGEKQGPTSEAEIGGELFFSFEDGWKKSAGEVGTNPISSAPDVAEKCKRVRVSVTRE
FT                   SESFWENRPRLKKDFRAKFHEKQENHEQTECEESKQDRDR"
     atgaaggcga agcgcgttga taacggcgag atgcggctag cagggtttga gaggagaaag        60
     atatcgctgg gcgaaagact gcttctggac ggggcggttg caaaaaatag cagccggcgg       120
     cgggagagaa acggggtggg ttggggagaa aaacaagggc caacaagcga agccgagatt       180
     ggaggcgagc tctttttttc cttcgaagat gggtggaaga agagcgctgg ggaagtggga       240
     acgaatccta tttcttctgc acctgatgtg gcggagaagt gtaagagggt gagggtgtca       300
     gtgacaagag agagtgagag cttctgggaa aaccgtccga ggctgaagaa agattttcgc       360
     gccaaattcc acgagaaaca ggagaaccac gagcagacag aatgcgaaga aagcaagcaa       420
     gatagagata gatga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page