(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE396

ASPNC_1.PE396        Location/Qualifiers
FT   CDS_pept        join(979942..980039,980067..980113,980277..980446,
FT                   980519..980637,980774..980878,981078..981161,
FT                   981269..981334,981613..981894,982008..982085,9
FT                   82393..982492)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877889"
FT                   /orf_name="An01g04170"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36953.1"
FT                   /db_xref="UniParc:UPI0000EF9E42"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8F6"
FT                   /transl_table=1
FT                   /translation="MVSHILGLNPVGDNVGYRAKHPSRLRCRNARLGQIVCPGAVDGWN
FT                   GDPVATKTQESPGREWKTECGYGVTPVGSDDSKGGSPLQSTARMISSRSRLSSPIKADI
FT                   AGENAKAVGGRETDREMNSDQGCLSVPSLRTLRTYVPHYILIDPDASHHFGKPKHSTRL
FT                   MIDRRQTAEAWFMNRGRCGSKPDAVCWTEGTRTIERKKQVTYGGGSATCKKNLPVLAKP
FT                   YESTTLAGKSDKGCSANSTPIEPMLIAMPRAACHTDIFIQTGGNIEIQAANVRRTVLLE
FT                   GRGDGTLSGWWAGRNLSWSYGRAAERLSFATLLTTYATLIGDLVCVRDTHSNAPQISAA
FT                   GRAHGRHLITRILGLTGSSITVLLIAVTDVCAKKAEPYIPGQ"
     atggtgtctc acatactggg gttgaaccct gtcggcgaca acgttggtta cagggcaaaa        60
     catccgagca ggctccgatg taggaatgct aggctggggc aaatagtgtg tcctggtgct       120
     gtagatggtt ggaatggaga cccggtagca acgaaaacac aagaaagccc gggccgggag       180
     tggaaaaccg agtgtggata cggggtcact ccagtgggat ctgacgactc gaaaggcggg       240
     tctccactgc agtcaaccgc tcgaatgatc agcagtcgtt cgcgattgtc gtcgccaatc       300
     aaagccgaca tcgctggaga gaacgccaag gctgtgggag gaagagagac agacagggaa       360
     atgaatagtg accagggctg tctgtctgtt ccgtctctgc ggactctccg tacttacgta       420
     ccgcactaca tcctgattga ccctgatgca tcccaccact tcgggaaacc taagcattca       480
     actaggttaa tgatagatag aagacaaacg gcagaggctt ggttcatgaa ccgtggacgg       540
     tgtggaagca aacctgatgc tgtctgctgg acagaaggaa caagaacaat cgaacggaaa       600
     aagcaagtta cctatggagg tggatcagca acatgcaaga agaaccttcc agtgctggct       660
     aaaccctatg agtctacaac attggcgggg aagtccgaca agggttgttc tgcgaatagc       720
     actccaatcg aacccatgct tatagccatg cctcgtgccg cttgccacac cgatattttc       780
     atccagacgg gcggcaatat tgagattcag gcggctaatg tacgtaggac tgtgcttttg       840
     gaggggaggg gcgacggtac tctctccggc tggtgggcag gcagaaacct atcatggagc       900
     tacgggcgcg cagctgagcg actcagcttc gcaactctac tgaccaccta tgccacactc       960
     atcggtgacc tcgtgtgcgt gcgcgataca cattccaatg ctccccagat ttcagcggca      1020
     gggcgtgctc atggcagaca tcttatcacc cgaattctag gcctcaccgg gtcgagcatt      1080
     accgtattgc ttattgcagt cacggatgtt tgcgcaaaga aggctgagcc ctacatccct      1140
     gggcaatag                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page