(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE4

ASPNC_1.PE4          Location/Qualifiers
FT   CDS_pept        5250..>6158
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874677"
FT                   /orf_name="An01g00040"
FT                   /product="Function: in S. cerevisiae TFIIF is required for
FT                   initiation at most"
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="catalytic activity"
FT                   /function="transcription activator activity"
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK36849.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="GO:0016563"
FT                   /db_xref="InterPro:IPR008851"
FT                   /db_xref="InterPro:IPR011039"
FT                   /db_xref="UniParc:UPI0000EF9E9A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7B4"
FT                   /transl_table=1
FT                   /translation="MTTPTNDQTLKTPTGSNGPPPVRIRRPKVADPLVRPKRRPAIRPP
FT                   APTSAANGASRMPNSRPVTSSQLPGARVEKSLNPKNDFSANGFSGPLLSENYVDYPIVT
FT                   TRRALREGLKHHIARFTSKKSVDPRDESQFTRPVRLQRRDPRARPNEAHVERGQLNSKP
FT                   GSEQSTQMDELEREELEARKAAREKERAENMAQIAPSVGSAPKRHNAPKQKTQQVTKTD
FT                   MTPEEIARTRIKYEEALPWHLEDFDNKNIWVGNYEAALSETHAVFVLENTGKMRMIPVE
FT                   KWYRFSAKNTFKALTIEEAERL"
     atgaccacac ctactaatga tcagactctc aagaccccga cggggtcgaa cggtcctcca        60
     ccagtgcgga ttcgccggcc aaaagtggcg gatcccctcg tgcgaccaaa gaggagaccg       120
     gcaataagac ccccagctcc tacctcggca gcaaacggcg catcaaggat gcctaactca       180
     agaccagtca cttcaagcca gctaccaggg gctcgcgtcg agaaaagcct gaacccgaag       240
     aatgattttt cggcaaacgg attcagcggc ccgttgttgt ctgagaatta cgttgattac       300
     cccatcgtga ctacaagacg agcattgcgc gaaggcttga agcaccatat cgccaggttc       360
     acctcgaaaa agtccgtcga tcctcgcgat gaaagtcagt ttactcgccc tgttaggctc       420
     cagcgccgag atccacgagc acggccgaat gaagcacacg ttgagagagg ccagctcaat       480
     tcgaaacccg gctccgaaca aagcacccag atggacgaac ttgaacgcga ggagttggag       540
     gctaggaaag cagctcgtga aaaggagcgc gcagagaaca tggcccaaat agctccttcc       600
     gtcggatcag cgccgaaaag gcataatgcc cccaaacaga aaactcagca agtgactaaa       660
     acagacatga ccccagagga gatagccagg actcggatca agtatgagga ggcccttcca       720
     tggcacttgg aggattttga caacaaaaat atatgggtag gaaattatga agccgcgttg       780
     tcagagaccc acgcagtctt tgtgcttgag aatacaggga agatgagaat gataccggtt       840
     gagaagtggt atcgcttcag tgcgaagaat acattcaagg ctttgaccat agaagaagcc       900
     gagagactt                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page