(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE40

ASPNC_1.PE40         Location/Qualifiers
FT   CDS_pept        join(111845..111907,111969..112646)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874699"
FT                   /orf_name="An01g00460"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43434.1"
FT                   /db_xref="UniParc:UPI0000EF9F22"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7F0"
FT                   /transl_table=1
FT                   /translation="MPSQEGVVAAFLVINKEQRGESWTYEPRSPVSQGSILGQSLCHAG
FT                   NLPVINSIKMSYRRPPFLVPSKRYSPKTIIFSSFDCLLNQRSNLAQASTSKKMKYISNW
FT                   HPVHRVPIVDGKFQNPTTGIIEEIADKYFVICGPPFIKATWIILKPGSGFLITCTDFPP
FT                   PIEDVFVAIAEHVKAKAYEIENISATKYEMTVVCSSDLTEEMMHEVVMRMKRELWKDVY
FT                   IPPEEIAAFEAFVEEERKKENPRF"
     atgccatcac aggagggggt agttgcggca tttttggtca taaacaaaga acaaagaggg        60
     gaatcgtgga catatgagcc ccgctctcca gtctcacagg ggtcgatatt aggccagagt       120
     ctatgtcatg ctggaaacct gccagtcatc aatagtatca aaatgtctta tagaaggccg       180
     cccttccttg tcccatccaa aagatatagc ccaaaaacca ttatcttttc ttcctttgac       240
     tgccttttaa atcaacgctc aaatctagct caggcttcaa cgagtaaaaa aatgaagtac       300
     atctcaaact ggcatcctgt tcacagggtg cctatcgttg atggaaaatt ccaaaatccc       360
     actaccggta tcattgaaga aattgccgac aagtactttg tgatctgtgg tcctccattc       420
     atcaaagcta catggatcat tctgaaacct ggctccggat ttctcattac atgcaccgac       480
     ttcccacccc cgatcgaaga tgttttcgtg gctattgcgg agcatgtaaa ggcaaaggca       540
     tacgaaatcg aaaacatcag tgcaaccaag tatgagatga cagtggtctg ttcgagcgat       600
     ctgactgagg agatgatgca tgaggtggtg atgcggatga aacgggaatt gtggaaggat       660
     gtgtacattc ctccggagga gattgcggct ttcgaggcgt ttgtggagga ggaacggaag       720
     aaggagaacc ctcggttctg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page