(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE414

ASPNC_1.PE414        Location/Qualifiers
FT   CDS_pept        join(1022402..1023005,1023062..1023828)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210922" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877895"
FT                   /orf_name="An01g04360"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36971.1"
FT                   /db_xref="UniParc:UPI0000EF9E6E"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H4"
FT                   /transl_table=1
FT                   /translation="MDLICSSPVVPAPIQEMVAEPIDIILDEPTDTCAMVEEKAEEIIE
FT                   AENERLDQLMIEFTRGFDPGTFVDEVSNSLPGILKDIFPGSYEHLLSMLFESDDKMHAT
FT                   QMKLEEWLLKRYPQVLNKIDTERQETNITDETYFGAEIEILRKMLAFLRKESDKPVFWL
FT                   NSRRASPSKAREQLEASIRVIELFKSDVMVAMKLDTEDRKIYNPLPVSTERTALLSIKQ
FT                   LRIDACKASLSWEGYMDSAIVLTSFFHAYKAYTCAHKPDKARAWGWLPPQGLAPPRLSA
FT                   EIAQVGDLVRWEFEHENGAFDLLLKTALWLGLARGLPAVHLFCDVARLFTTHKPSPTAN
FT                   EPYIRFLRHLAQTRVSIAGIKSTPSTPVPFKQSDENTNRGYFEDVVDSDKNLEKDLTKT
FT                   LSLLRINTARDIKLTATPPKCSFRKKAKMIEKACAVEENHTEKWPQKDPASQGNSFS"
     atggatctca tctgctcttc tccggtcgtc cctgcaccga ttcaggagat ggtcgccgag        60
     ccgatcgaca tcatacttga tgagcctacg gacacctgtg cgatggtgga agagaaagct       120
     gaggagatta tcgaggctga gaatgagagg cttgaccaac tgatgataga atttaccaga       180
     ggttttgatc ctggaacttt cgtcgatgag gtctctaact cgctccccgg tatcctcaaa       240
     gatatattcc caggttccta cgagcatctt ctgagcatgc tgttcgaaag tgatgacaag       300
     atgcacgcta cccagatgaa actagaggaa tggcttttga aacgatatcc tcaggttctc       360
     aacaagatcg acaccgaacg tcaagaaacg aacataaccg atgagacgta tttcggggct       420
     gagattgaga tcttgaggaa gatgttagca ttcctgcgca aggaatctga taagccggtg       480
     ttctggctca actctcggcg tgcaagtcct agcaaagctc gtgagcagct tgaagcatcc       540
     atcagggtca tcgaattgtt caaaagcgat gtcatggttg cgatgaaact ggacacggag       600
     gacagaaaaa tctacaatcc tcttcccgtg tccacagaac gcaccgctct gctgagtatc       660
     aaacaacttc ggattgacgc atgcaaggcc tcactttctt gggaaggcta tatggactct       720
     gccatcgtac tcacttcttt ctttcacgct tacaaggcct atacctgcgc acacaagccg       780
     gacaaagccc gtgcatgggg ctggctccca ccccagggac ttgcgccgcc acgcttgtcc       840
     gcagagatag ctcaggtagg cgacttggta agatgggagt tcgagcatga gaacggagcc       900
     ttcgatcttt tactcaagac tgcactttgg ctgggtttgg cgagaggcct cccagctgtg       960
     catctgttct gtgacgtcgc tcgacttttc acgactcata agccctcccc aacggcaaac      1020
     gagccatata tccgatttct gcggcatctg gcccagacaa gagtctccat tgccggaatc      1080
     aagtccacgc cgtccactcc tgtcccattc aagcagtccg acgaaaatac caatcgcggt      1140
     tacttcgaag acgtagttga ttcagacaaa aacctggaga aggacctaac aaagaccctt      1200
     tcattgcttc gcatcaacac ggccagggat ataaagctaa ctgctacgcc tcccaaatgc      1260
     tcgtttcgca agaaggcgaa gatgatcgag aaggcttgtg ctgtggaaga gaaccacacg      1320
     gagaagtggc cccagaagga tccggcaagt caagggaatt cctttagtta g               1371
//

If you have problems or comments...

PBIL Back to PBIL home page